(data stored in ACNUC30567 zone)

HOGENOMDNA: ACAM1_4.PE11

ACAM1_4.PE11         Location/Qualifiers
FT   CDS             complement(5263..5556)
FT                   /locus_tag="AM1_C0011"
FT                   /gene_family="HOG000022980" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340466"
FT                   /db_xref="GeneID:5686233"
FT                   /translation="MNTTLTQMEQWIDERVTDPLHPEYFLLYAQVEFWPGVREGGALEE
FT                   YYIIIKNRVGSVGDRLRDWVLKRFGVSARLADWETIPSLRQLRAESQYEDEF"
FT                   /protein_id="YP_001521460.1"
     MNTTLTQMEQ WIDERVTDPL HPEYFLLYAQ VEFWPGVREG GALEEYYIII KNRVGSVGDR        60
     LRDWVLKRFG VSARLADWET IPSLRQLRAE SQYEDEF                                 97
//

If you have problems or comments...

PBIL Back to PBIL home page