(data stored in ACNUC30567 zone)

HOGENOMDNA: ACAM1_4.PE12

ACAM1_4.PE12         Location/Qualifiers
FT   CDS             5909..6154
FT                   /locus_tag="AM1_C0012"
FT                   /gene_family="HOG000225389" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="helix-turn-helix domain-containing protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340467"
FT                   /db_xref="GeneID:5686234"
FT                   /translation="MLTLLELVENLELSFSQWFLLMRRKQGLTQDDIAEALGISGQSVS
FT                   NWERGRSIPTLTIDQVKTLCKILDCTLNDIPSSDTE"
FT                   /protein_id="YP_001521461.1"
     MLTLLELVEN LELSFSQWFL LMRRKQGLTQ DDIAEALGIS GQSVSNWERG RSIPTLTIDQ        60
     VKTLCKILDC TLNDIPSSDT E                                                  81
//

If you have problems or comments...

PBIL Back to PBIL home page