(data stored in ACNUC30567 zone)

HOGENOMDNA: ACAM1_4.PE13

ACAM1_4.PE13         Location/Qualifiers
FT   CDS             6861..10283
FT                   /locus_tag="AM1_C0013"
FT                   /gene_family="HOG000023186" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340468"
FT                   /db_xref="GeneID:5686235"
FT                   /translation="MTLSGQIEGYRYLGQSKDGLWGKYVLDDGKDLSQEDRERRWQEQR
FT                   ILREQRAQAEAQRHAQSLPASERDQHYRQLLDQLTLHPADRADLHRRGFTNEQIQDWGV
FT                   KSVEQWQSLSSELPHTLPGVGLDGQSLITPRPGYLCSIVDAEDLIVGFQVRARTSEGGR
FT                   YYWLTGKTRKRPTGPTPHLPTGELPLAVHRPEQITRDAIALVEGTGAKPHLLAQRLGQV
FT                   TIGAAGGLFAASPATLKASLAQLGANTIEFYPDAGAIQNKSVLRQYRATWKLLKDWGYT
FT                   VTVAWWKQTDKRIHTDIDELDDFSQIQYLSVAEFERIAAQCNGLLHQLQQALSKLTRPS
FT                   SPVQGFATPNDQQTHPPNPRGTKRTAPDDKRLATLPATSRRAKRSRRRTARLLTAHRRH
FT                   GYISKLRLENYRRRIRRHTSRATHSRCSSLQSRPGDNGTLETTTPLVHEYEPGQRLQTW
FT                   QTLISSGFPYILDQSQPGTGKSYDSGNVTPIGFGVEQVIYLSDQHRNPTVSTLEQGNGW
FT                   CDLEARHGGLNRVKNRLQRSAKGDAFAVPANCSRIGVLNALRDKNIPGADTANLICGTC
FT                   VAREACINANGPGYGFLNQRRNVLGVPLLRAHPDSLPDPEDYPLENTMLIWDEPGQNFQ
FT                   VKQSVTVTFTDLQQTISGLITYPEIFALVQPLLSALLPLMDGSEKLGKFGLNHLAVKGR
FT                   LPDMTGVKLGEIALILMPNLGFLNTTSDYGIDLADLPKQLRKKFSERDSEMAEQARNGV
FT                   VKQWLVPLIRILQGGAGCIQVSRYGLLTLNTPNPRHRDLAQAAQANVFLDATLSREDLA
FT                   LKLGCSPDEILVVRQAVPDTGNLEVIQVTDMGRVGMSRGGDQTKRIDALVKHYQELDAA
FT                   STKTIDFKKFEKDGAWWRDSRGVNDFLNVQTLILVGTPCRNLNDLAAEFAMVCGHYPDE
FT                   EESAFKAFVDRSILAEIHQAIGRLRAHRRPGESLQVVLISNIEMDCPVDRVQAKELTLD
FT                   AAHKAERVRLAIESAILQLQAKGKKVTQQVVSAMTQIPRGTIARYWRLFISLLEGLNSR
FT                   MNNSKKVLEADQDCHQAIAGVLDELSELPVNDLLPSLNEVFFDWLKPREWANVWDKVNA
FT                   SSQMAILEGIAMVLPLKMLDQALSEIEMQFQIC"
FT                   /protein_id="YP_001521462.1"
     MTLSGQIEGY RYLGQSKDGL WGKYVLDDGK DLSQEDRERR WQEQRILREQ RAQAEAQRHA        60
     QSLPASERDQ HYRQLLDQLT LHPADRADLH RRGFTNEQIQ DWGVKSVEQW QSLSSELPHT       120
     LPGVGLDGQS LITPRPGYLC SIVDAEDLIV GFQVRARTSE GGRYYWLTGK TRKRPTGPTP       180
     HLPTGELPLA VHRPEQITRD AIALVEGTGA KPHLLAQRLG QVTIGAAGGL FAASPATLKA       240
     SLAQLGANTI EFYPDAGAIQ NKSVLRQYRA TWKLLKDWGY TVTVAWWKQT DKRIHTDIDE       300
     LDDFSQIQYL SVAEFERIAA QCNGLLHQLQ QALSKLTRPS SPVQGFATPN DQQTHPPNPR       360
     GTKRTAPDDK RLATLPATSR RAKRSRRRTA RLLTAHRRHG YISKLRLENY RRRIRRHTSR       420
     ATHSRCSSLQ SRPGDNGTLE TTTPLVHEYE PGQRLQTWQT LISSGFPYIL DQSQPGTGKS       480
     YDSGNVTPIG FGVEQVIYLS DQHRNPTVST LEQGNGWCDL EARHGGLNRV KNRLQRSAKG       540
     DAFAVPANCS RIGVLNALRD KNIPGADTAN LICGTCVARE ACINANGPGY GFLNQRRNVL       600
     GVPLLRAHPD SLPDPEDYPL ENTMLIWDEP GQNFQVKQSV TVTFTDLQQT ISGLITYPEI       660
     FALVQPLLSA LLPLMDGSEK LGKFGLNHLA VKGRLPDMTG VKLGEIALIL MPNLGFLNTT       720
     SDYGIDLADL PKQLRKKFSE RDSEMAEQAR NGVVKQWLVP LIRILQGGAG CIQVSRYGLL       780
     TLNTPNPRHR DLAQAAQANV FLDATLSRED LALKLGCSPD EILVVRQAVP DTGNLEVIQV       840
     TDMGRVGMSR GGDQTKRIDA LVKHYQELDA ASTKTIDFKK FEKDGAWWRD SRGVNDFLNV       900
     QTLILVGTPC RNLNDLAAEF AMVCGHYPDE EESAFKAFVD RSILAEIHQA IGRLRAHRRP       960
     GESLQVVLIS NIEMDCPVDR VQAKELTLDA AHKAERVRLA IESAILQLQA KGKKVTQQVV      1020
     SAMTQIPRGT IARYWRLFIS LLEGLNSRMN NSKKVLEADQ DCHQAIAGVL DELSELPVND      1080
     LLPSLNEVFF DWLKPREWAN VWDKVNASSQ MAILEGIAMV LPLKMLDQAL SEIEMQFQIC      1140
//

If you have problems or comments...

PBIL Back to PBIL home page