(data stored in ACNUC30567 zone)

HOGENOMDNA: ACAM1_4.PE15

ACAM1_4.PE15         Location/Qualifiers
FT   CDS             complement(13046..14269)
FT                   /locus_tag="AM1_C0015"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340470"
FT                   /db_xref="GeneID:5686237"
FT                   /translation="MGLAVIHWITLKPLGWPLNVQLPLLSRLPMKVSLFLGFNHHRLPM
FT                   KCKTITSWLGVMVVGLIIQACNQHSGGGTVSVDPTLFYEDALVGDIAEELCTLSGGTET
FT                   ICYRITVKSTPVDHQAVPWCPETISDGDKAGGIWPDGGKINNVDGAFIKNLEAFYSDDQ
FT                   WKLYRDDGSVRVTDSKEACVAARPNVDEDYQNFCVQCLLSYLEKGMVNTHIIPIKPVQQ
FT                   TKPRQIARTSGGLALNGVNFDPPAPTNAILSARTLTPFDDCGGHIHLNHGYHYHAHTGC
FT                   LTEVAQEDTHSLMIGHALEGFSLHARLEEQSAEESSLDECRGHSNETRGYHYHVTDPGS
FT                   NSFINCFQRSMGARLKEMGKGRPVMPHQQTIEGDRVAPLVRVRENPEDRMMKQSKNLIV
FT                   HNLIYNLA"
FT                   /protein_id="YP_001521464.1"
     MGLAVIHWIT LKPLGWPLNV QLPLLSRLPM KVSLFLGFNH HRLPMKCKTI TSWLGVMVVG        60
     LIIQACNQHS GGGTVSVDPT LFYEDALVGD IAEELCTLSG GTETICYRIT VKSTPVDHQA       120
     VPWCPETISD GDKAGGIWPD GGKINNVDGA FIKNLEAFYS DDQWKLYRDD GSVRVTDSKE       180
     ACVAARPNVD EDYQNFCVQC LLSYLEKGMV NTHIIPIKPV QQTKPRQIAR TSGGLALNGV       240
     NFDPPAPTNA ILSARTLTPF DDCGGHIHLN HGYHYHAHTG CLTEVAQEDT HSLMIGHALE       300
     GFSLHARLEE QSAEESSLDE CRGHSNETRG YHYHVTDPGS NSFINCFQRS MGARLKEMGK       360
     GRPVMPHQQT IEGDRVAPLV RVRENPEDRM MKQSKNLIVH NLIYNLA                     407
//

If you have problems or comments...

PBIL Back to PBIL home page