(data stored in ACNUC30567 zone)

HOGENOMDNA: ACAM1_4.PE16

ACAM1_4.PE16         Location/Qualifiers
FT   CDS             14446..15729
FT                   /locus_tag="AM1_C0016"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340471"
FT                   /db_xref="GeneID:5686238"
FT                   /translation="MAQGTNLLYQRYRSIALAVYICVLLAGLLDWLDGGLGPRSIITAP
FT                   DSLRFFVFASTVLALTGLELRTLVNGTYSPTRKKNVLLFLVRLVLFSGACLVTDLHYSK
FT                   ILFLPILLYGYFTVSQRLSYVIALLGVAILFILSAANIGGIRPPPPLGVSKLGGLIDRS
FT                   TGSLIALLFTLLLAQAMSEAIQAQQKLTHLLQSLESSHRQLQAYASRVADLAAIEERNR
FT                   LARDIHDSLGHHLAAINIQLEKASAYRERDSDRAYEAVKHAQETVQDALKDVRASVSSL
FT                   RQEGIPFAFQASLEELIRRMDHSDLDITLNQSGECVNYSSLKLMTLYRVLQEGLTNIHK
FT                   HAHASQAHINLNFGPQNITLELIDNGLGFDVAAWKSQKNQQTNHGIIGLQERLSLVGGT
FT                   LDITSHSQATTLAINIPQDLPQINYRAE"
FT                   /protein_id="YP_001521465.1"
     MAQGTNLLYQ RYRSIALAVY ICVLLAGLLD WLDGGLGPRS IITAPDSLRF FVFASTVLAL        60
     TGLELRTLVN GTYSPTRKKN VLLFLVRLVL FSGACLVTDL HYSKILFLPI LLYGYFTVSQ       120
     RLSYVIALLG VAILFILSAA NIGGIRPPPP LGVSKLGGLI DRSTGSLIAL LFTLLLAQAM       180
     SEAIQAQQKL THLLQSLESS HRQLQAYASR VADLAAIEER NRLARDIHDS LGHHLAAINI       240
     QLEKASAYRE RDSDRAYEAV KHAQETVQDA LKDVRASVSS LRQEGIPFAF QASLEELIRR       300
     MDHSDLDITL NQSGECVNYS SLKLMTLYRV LQEGLTNIHK HAHASQAHIN LNFGPQNITL       360
     ELIDNGLGFD VAAWKSQKNQ QTNHGIIGLQ ERLSLVGGTL DITSHSQATT LAINIPQDLP       420
     QINYRAE                                                                 427
//

If you have problems or comments...

PBIL Back to PBIL home page