(data stored in ACNUC30567 zone)

HOGENOMDNA: ACAM1_4.PE18

ACAM1_4.PE18         Location/Qualifiers
FT   CDS             16820..18298
FT                   /locus_tag="AM1_C0018"
FT                   /gene_family="HOG000023188" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="RND family efflux transporter MFP subunit"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340473"
FT                   /db_xref="GeneID:5686240"
FT                   /translation="MAMMVLLSACTVQAADDAKKSKASPKIAAVDVAIAKPNTDHILDS
FT                   FTGTTAPIQEVMVRSQVDGQLQKLAVEVGDRVEKGQILGQQDDGVLTDTVNTARAEREA
FT                   QVVDVAKARSQVGAAKANVEQARLALVQAKGNVLQLQNAARANIEAARLEAQQNRQDAN
FT                   RLTQLANAGATSQQEAEQARTLAQRTQQTLVNTQANSVQEITQAQTAVKTAEQALQAAI
FT                   AQVDIEQGTVNATQRRVYAQQSVLNQALGQRSFTVLSAPLTGVVMERLSEAGNLLQTGD
FT                   SILRLGDFKKIKITIQVPARLLSQLRMGQQAKITLDAFPQQEWSGKITLISPLANTTSR
FT                   LLPIEILMDNPGKMSSGLLARVSFVQPQQGRVWVPEAAIQTSQSRKGPSSTPKPSNPDH
FT                   PSSQQRPSPQPPTDRKQTPTSNQATLFVLDKASPQPRVTSRQVQLGAQRNGQVEIIQGL
FT                   TSGESFVSRSSQPLKDGATVRLSALSESSSSVNP"
FT                   /protein_id="YP_001521467.1"
     MAMMVLLSAC TVQAADDAKK SKASPKIAAV DVAIAKPNTD HILDSFTGTT APIQEVMVRS        60
     QVDGQLQKLA VEVGDRVEKG QILGQQDDGV LTDTVNTARA EREAQVVDVA KARSQVGAAK       120
     ANVEQARLAL VQAKGNVLQL QNAARANIEA ARLEAQQNRQ DANRLTQLAN AGATSQQEAE       180
     QARTLAQRTQ QTLVNTQANS VQEITQAQTA VKTAEQALQA AIAQVDIEQG TVNATQRRVY       240
     AQQSVLNQAL GQRSFTVLSA PLTGVVMERL SEAGNLLQTG DSILRLGDFK KIKITIQVPA       300
     RLLSQLRMGQ QAKITLDAFP QQEWSGKITL ISPLANTTSR LLPIEILMDN PGKMSSGLLA       360
     RVSFVQPQQG RVWVPEAAIQ TSQSRKGPSS TPKPSNPDHP SSQQRPSPQP PTDRKQTPTS       420
     NQATLFVLDK ASPQPRVTSR QVQLGAQRNG QVEIIQGLTS GESFVSRSSQ PLKDGATVRL       480
     SALSESSSSV NP                                                           492
//

If you have problems or comments...

PBIL Back to PBIL home page