(data stored in ACNUC30567 zone)

HOGENOMDNA: ACAM1_4.PE19

ACAM1_4.PE19         Location/Qualifiers
FT   CDS             18298..21555
FT                   /locus_tag="AM1_C0019"
FT                   /gene_family="HOG000158131" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="acriflavin resistance protein, putative"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340474"
FT                   /db_xref="GeneID:5686241"
FT                   /translation="MERSTLSLSTLSIRRHIGVFMLTLTIVVLGLFFLSTLQVDLLPSI
FT                   TYPRIGVRLEAPGISPDVAVDEITDPLEEALLATEGVVQIYSRTQEGSVSVDLYFQPGG
FT                   NIDQALNDATAALNRALNDLPDTIEQPRLFKFDPSQLPVYEMALTSPGLDDSELRVFAE
FT                   ETLNRELGLVPGVSSAEVSGAADEEIQINLDLNRMQTIGVSMTEVLNALSTRNQDISGG
FT                   QILGQLTEPLTRTIGQFQSVDEIESLILNVAALSSTNETGGAPLSTTQQALQGDQQVYL
FT                   RDIAEVVDGAAEQRVFVNLNQTPAVKLSLQKQPDANTVVVVDGIKAKLAELVQREIIPA
FT                   EMVIIPTLDESVFIRNAIRNVAISGLSGMVLAALAVLLFLGSLRQTLIIVLAIPLATLT
FT                   SIILMRLFGLSMNVFSLGGLALGVGIVVDNAIVMLETIVQGTQTQASNNGYSKQEKILR
FT                   QAEQSSRQVESALVASTSTNLVAVLPFLMIGGFIALLFNELLLTISFAISASILIALTV
FT                   VPMLASRLLMVHRSSRVGQTWLLVQFRERFERATLSYCRGLGWVLKWRWQVVVSAILIL
FT                   GISSLGMLEQIPQEILPPINTGQASLVAQFPVGTTLEQNRLVMAKVEAILAEQPETAYA
FT                   FITAGGSIRGTNLSENPLRGSGSITLKPNADVEAYTQKVSQAIDKLNLVDIRIRVSPGQ
FT                   VRGLITSNSPIRGADIDVMLQGENSQRLSQAGRQVLGALSDQVTGARFRPDNDPDQPEL
FT                   QISPDWERVAALGLSAQQIGETIQTAVEGWVPTQLQQGSRLIDIRVQLDPKSLQMEEQL
FT                   AQLPLFTEGNQFVQLADVAQIGVGAAPLEIQRINQQPVYLVGGNLAEGARLSDALAEVE
FT                   SVLTTLTLPDGVSLLPSTAAQSNRALQQALQTLGGLAAFLVFVVMAVQYNSLIDPLVIL
FT                   FTVPLALSGGLFGLYITQTAIGATVIVGVVLLVGIVVNNAIIMVELANQIYFQSGQDRQ
FT                   AAILQAAPQRLKPIMMTTMTTVLGMLPLALGIGQGSEFLQPLGIVVFAGLSLATLLTLY
FT                   IIPCFYVILHNAECQQRGLSLKTKTLPFHRLFQRLRS"
FT                   /protein_id="YP_001521468.1"
     MERSTLSLST LSIRRHIGVF MLTLTIVVLG LFFLSTLQVD LLPSITYPRI GVRLEAPGIS        60
     PDVAVDEITD PLEEALLATE GVVQIYSRTQ EGSVSVDLYF QPGGNIDQAL NDATAALNRA       120
     LNDLPDTIEQ PRLFKFDPSQ LPVYEMALTS PGLDDSELRV FAEETLNREL GLVPGVSSAE       180
     VSGAADEEIQ INLDLNRMQT IGVSMTEVLN ALSTRNQDIS GGQILGQLTE PLTRTIGQFQ       240
     SVDEIESLIL NVAALSSTNE TGGAPLSTTQ QALQGDQQVY LRDIAEVVDG AAEQRVFVNL       300
     NQTPAVKLSL QKQPDANTVV VVDGIKAKLA ELVQREIIPA EMVIIPTLDE SVFIRNAIRN       360
     VAISGLSGMV LAALAVLLFL GSLRQTLIIV LAIPLATLTS IILMRLFGLS MNVFSLGGLA       420
     LGVGIVVDNA IVMLETIVQG TQTQASNNGY SKQEKILRQA EQSSRQVESA LVASTSTNLV       480
     AVLPFLMIGG FIALLFNELL LTISFAISAS ILIALTVVPM LASRLLMVHR SSRVGQTWLL       540
     VQFRERFERA TLSYCRGLGW VLKWRWQVVV SAILILGISS LGMLEQIPQE ILPPINTGQA       600
     SLVAQFPVGT TLEQNRLVMA KVEAILAEQP ETAYAFITAG GSIRGTNLSE NPLRGSGSIT       660
     LKPNADVEAY TQKVSQAIDK LNLVDIRIRV SPGQVRGLIT SNSPIRGADI DVMLQGENSQ       720
     RLSQAGRQVL GALSDQVTGA RFRPDNDPDQ PELQISPDWE RVAALGLSAQ QIGETIQTAV       780
     EGWVPTQLQQ GSRLIDIRVQ LDPKSLQMEE QLAQLPLFTE GNQFVQLADV AQIGVGAAPL       840
     EIQRINQQPV YLVGGNLAEG ARLSDALAEV ESVLTTLTLP DGVSLLPSTA AQSNRALQQA       900
     LQTLGGLAAF LVFVVMAVQY NSLIDPLVIL FTVPLALSGG LFGLYITQTA IGATVIVGVV       960
     LLVGIVVNNA IIMVELANQI YFQSGQDRQA AILQAAPQRL KPIMMTTMTT VLGMLPLALG      1020
     IGQGSEFLQP LGIVVFAGLS LATLLTLYII PCFYVILHNA ECQQRGLSLK TKTLPFHRLF      1080
     QRLRS                                                                  1085
//

If you have problems or comments...

PBIL Back to PBIL home page