(data stored in ACNUC30567 zone)

HOGENOMDNA: ACAM1_4.PE20

ACAM1_4.PE20         Location/Qualifiers
FT   CDS             21749..22207
FT                   /locus_tag="AM1_C0020"
FT                   /gene_family="HOG000034464" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340475"
FT                   /db_xref="GeneID:5686242"
FT                   /translation="MTDYPRNFKLNRTDIAISYLLLRLLIGVNFLNHGLTRIGNIPSFV
FT                   ESMVKAMENSYFPEPLVRINAFLVPVVELIVGLLIILGWQTRIALTITSGLMVILMLGV
FT                   TSVQNWQAAGDQLVYGVILFILLACRSFNTVSVDYWLKRKTTPSERSR"
FT                   /protein_id="YP_001521469.1"
     MTDYPRNFKL NRTDIAISYL LLRLLIGVNF LNHGLTRIGN IPSFVESMVK AMENSYFPEP        60
     LVRINAFLVP VVELIVGLLI ILGWQTRIAL TITSGLMVIL MLGVTSVQNW QAAGDQLVYG       120
     VILFILLACR SFNTVSVDYW LKRKTTPSER SR                                     152
//

If you have problems or comments...

PBIL Back to PBIL home page