(data stored in ACNUC30567 zone)

HOGENOMDNA: ACAM1_4.PE27

ACAM1_4.PE27         Location/Qualifiers
FT   CDS             complement(26697..27077)
FT                   /locus_tag="AM1_C0027"
FT                   /gene_family="HOG000023190" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340482"
FT                   /db_xref="GeneID:5686249"
FT                   /translation="MKKHLQLLILTSLVSALPAKANPVADACFNSLIEHPDDRPDTAVL
FT                   SLTVEHNGSQYHVIDTTYRRPQPNPASRTYIRTDDRGGCEEILSYQIGSHPEADVYRER
FT                   LGSQVFDKVRQAFRQQQQQQQR"
FT                   /protein_id="YP_001521476.1"
     MKKHLQLLIL TSLVSALPAK ANPVADACFN SLIEHPDDRP DTAVLSLTVE HNGSQYHVID        60
     TTYRRPQPNP ASRTYIRTDD RGGCEEILSY QIGSHPEADV YRERLGSQVF DKVRQAFRQQ       120
     QQQQQR                                                                  126
//

If you have problems or comments...

PBIL Back to PBIL home page