(data stored in ACNUC30567 zone)

HOGENOMDNA: ACAM1_4.PE28

ACAM1_4.PE28         Location/Qualifiers
FT   CDS             complement(27088..28317)
FT                   /locus_tag="AM1_C0028"
FT                   /gene_family="HOG000023119" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="M23 peptidase domain-containing protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340483"
FT                   /db_xref="GeneID:5686250"
FT                   /translation="MQAKAEAEGVDLQPIDGSTGAPQLKGIPGQPGSDAAKSKFASASG
FT                   QSTGTQGTKAQTIGKSAWGSETDVHNLILTSALESTGTQNQIDVAVAIMNRVVSPKHPN
FT                   TITDVVFQPKQYEPNFGQAPVTSKEEAISRIARKTRSIQSAISTYETIEKALNDPNAIA
FT                   ASQAFLKGATDFRGQDWLHIRQPGDPYRGNTGANFYFQESQDPAIAAATLGVLGVESTA
FT                   VDPNSIYASASGHSIPCRPGAIASAGTVPFQQGSGVATGRLADPLGSHNYKLTSNYGPR
FT                   VNPVTGVPGFHYGIDLAHFAGTPFAAADGGVVVESFWNGDYGNWILIDHGNGLATWYAH
FT                   NKVNYVKAGDTVDPGQLIGEVGSTGNSTGPHIDLGVIEGYVTGNRDSGTVVNPRKYFNL
FT                   PPVGTFNQPQ"
FT                   /protein_id="YP_001521477.1"
     MQAKAEAEGV DLQPIDGSTG APQLKGIPGQ PGSDAAKSKF ASASGQSTGT QGTKAQTIGK        60
     SAWGSETDVH NLILTSALES TGTQNQIDVA VAIMNRVVSP KHPNTITDVV FQPKQYEPNF       120
     GQAPVTSKEE AISRIARKTR SIQSAISTYE TIEKALNDPN AIAASQAFLK GATDFRGQDW       180
     LHIRQPGDPY RGNTGANFYF QESQDPAIAA ATLGVLGVES TAVDPNSIYA SASGHSIPCR       240
     PGAIASAGTV PFQQGSGVAT GRLADPLGSH NYKLTSNYGP RVNPVTGVPG FHYGIDLAHF       300
     AGTPFAAADG GVVVESFWNG DYGNWILIDH GNGLATWYAH NKVNYVKAGD TVDPGQLIGE       360
     VGSTGNSTGP HIDLGVIEGY VTGNRDSGTV VNPRKYFNLP PVGTFNQPQ                   409
//

If you have problems or comments...

PBIL Back to PBIL home page