(data stored in ACNUC30567 zone)

HOGENOMDNA: ACAM1_4.PE29

ACAM1_4.PE29         Location/Qualifiers
FT   CDS             complement(30203..30343)
FT                   /locus_tag="AM1_C0029"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340484"
FT                   /db_xref="GeneID:5686251"
FT                   /translation="MKGCLVILLIVLTPFLLLSGPIGWILGIIAWILLLKDSGKNSGND
FT                   Q"
FT                   /protein_id="YP_001521478.1"
     MKGCLVILLI VLTPFLLLSG PIGWILGIIA WILLLKDSGK NSGNDQ                       46
//

If you have problems or comments...

PBIL Back to PBIL home page