(data stored in ACNUC30567 zone)

HOGENOMDNA: ACAM1_4.PE3

ACAM1_4.PE3          Location/Qualifiers
FT   CDS             complement(475..1260)
FT                   /locus_tag="AM1_C0003"
FT                   /gene_family="HOG000022974" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340458"
FT                   /db_xref="GeneID:5686225"
FT                   /translation="MKTLRWLIDLHPEFPASEIVAEYLRQHKKIEPIVIDRDDVMLGRW
FT                   PDTEDWIVGYGTMFAMTRLLRHPPLSTAIFDDYSSLRCSKYYSYIYPFLGRAFLFAPFG
FT                   ALPNLPLQRMFGDNIFVRSDTNYKLFPAEVLKTQELPHWVKTYSHHQNELAVVSEVVSF
FT                   ETEYRCFCRNGIFFCGSSYPDEPYSEVPQEIRSVAESVAQALGVTGMNMLTIDIGIHAG
FT                   EPKLVEIGGVNSWGIYGSNVADFIAAMEEEAIDRWEDFI"
FT                   /protein_id="YP_001521452.1"
     MKTLRWLIDL HPEFPASEIV AEYLRQHKKI EPIVIDRDDV MLGRWPDTED WIVGYGTMFA        60
     MTRLLRHPPL STAIFDDYSS LRCSKYYSYI YPFLGRAFLF APFGALPNLP LQRMFGDNIF       120
     VRSDTNYKLF PAEVLKTQEL PHWVKTYSHH QNELAVVSEV VSFETEYRCF CRNGIFFCGS       180
     SYPDEPYSEV PQEIRSVAES VAQALGVTGM NMLTIDIGIH AGEPKLVEIG GVNSWGIYGS       240
     NVADFIAAME EEAIDRWEDF I                                                 261
//

If you have problems or comments...

PBIL Back to PBIL home page