(data stored in ACNUC30567 zone)

HOGENOMDNA: ACAM1_4.PE30

ACAM1_4.PE30         Location/Qualifiers
FT   CDS             complement(30344..31792)
FT                   /locus_tag="AM1_C0030"
FT                   /gene_family="HOG000022985" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340485"
FT                   /db_xref="GeneID:5686252"
FT                   /translation="MSEIKTKKEALAAINKTKPKAKPTQPDPSQVQPQEPVPATLQDFH
FT                   LPELTHEFDAQTPTKTRRRLPIQIGVIGGSIFLILAVVQAVTSGNSDTPKPAVATRPQP
FT                   TIGMPEDDKDAIIKSQALQISELKQKYETGNVTNAPGQNKLTAVPQKPIVVPKTKPAQP
FT                   NRRPPSAAHRVTRPIQVRRSVPPSQPRIVYRNRPAPKPAVAARPPAPRPVAQAPKPAAN
FT                   FSLAQQSAFTPKPVQPARPVTPKPIRPIKVSTSHPVRKPITTKPFAKVPPTPPQGILVA
FT                   SLTGDLLEDNQVSDTPTALYPASSSPLGKGLISPGTTAKAKLDNPITWIPQNSDAIIGQ
FT                   RYLLTLSEDLGAMAKKGSKVIAEVTSAEGDFLSMQVVEVNQQPIEHVNLTDDSPEARKT
FT                   PVAVVQYKQSPYLQAKLKGQGEGFGNKLLRAGLNVGIDQLRSSSVGDRASSLVNSFAPN
FT                   RSSRSRSGLYHFDKEVEIYFVEGV"
FT                   /protein_id="YP_001521479.1"
     MSEIKTKKEA LAAINKTKPK AKPTQPDPSQ VQPQEPVPAT LQDFHLPELT HEFDAQTPTK        60
     TRRRLPIQIG VIGGSIFLIL AVVQAVTSGN SDTPKPAVAT RPQPTIGMPE DDKDAIIKSQ       120
     ALQISELKQK YETGNVTNAP GQNKLTAVPQ KPIVVPKTKP AQPNRRPPSA AHRVTRPIQV       180
     RRSVPPSQPR IVYRNRPAPK PAVAARPPAP RPVAQAPKPA ANFSLAQQSA FTPKPVQPAR       240
     PVTPKPIRPI KVSTSHPVRK PITTKPFAKV PPTPPQGILV ASLTGDLLED NQVSDTPTAL       300
     YPASSSPLGK GLISPGTTAK AKLDNPITWI PQNSDAIIGQ RYLLTLSEDL GAMAKKGSKV       360
     IAEVTSAEGD FLSMQVVEVN QQPIEHVNLT DDSPEARKTP VAVVQYKQSP YLQAKLKGQG       420
     EGFGNKLLRA GLNVGIDQLR SSSVGDRASS LVNSFAPNRS SRSRSGLYHF DKEVEIYFVE       480
     GV                                                                      482
//

If you have problems or comments...

PBIL Back to PBIL home page