(data stored in ACNUC30567 zone)

HOGENOMDNA: ACAM1_4.PE31

ACAM1_4.PE31         Location/Qualifiers
FT   CDS             complement(31792..32511)
FT                   /locus_tag="AM1_C0031"
FT                   /gene_family="HOG000022986" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340486"
FT                   /db_xref="GeneID:5686253"
FT                   /translation="MLKLQDPTETHKKQPPYVLYAILGVFTLNFFSSCGAFLSSSRSAQ
FT                   LASDQSTIYVQTQDDETVQAEKVDPLHREDALLRTYAYELVKVGWTWNGGSPPKKHNDH
FT                   IYPGELFAVAQSIDPLLRDGWLEIEHQKYEKAQQPIQEYLSGQWQSVVEIKRDTDIHLT
FT                   QIQPGQWQIHVISIRTHRSKDGKSFPEKLNKKLVVEAVIPTEGEAQRLFGDSYSQLNHL
FT                   ITKYQRHGLMITSIEDF"
FT                   /protein_id="YP_001521480.1"
     MLKLQDPTET HKKQPPYVLY AILGVFTLNF FSSCGAFLSS SRSAQLASDQ STIYVQTQDD        60
     ETVQAEKVDP LHREDALLRT YAYELVKVGW TWNGGSPPKK HNDHIYPGEL FAVAQSIDPL       120
     LRDGWLEIEH QKYEKAQQPI QEYLSGQWQS VVEIKRDTDI HLTQIQPGQW QIHVISIRTH       180
     RSKDGKSFPE KLNKKLVVEA VIPTEGEAQR LFGDSYSQLN HLITKYQRHG LMITSIEDF        239
//

If you have problems or comments...

PBIL Back to PBIL home page