(data stored in ACNUC30567 zone)

HOGENOMDNA: ACAM1_4.PE32

ACAM1_4.PE32         Location/Qualifiers
FT   CDS             complement(32541..33821)
FT                   /locus_tag="AM1_C0032"
FT                   /gene_family="HOG000022988" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340487"
FT                   /db_xref="GeneID:5686254"
FT                   /translation="MSVIGLTLLFIALGEVSAHAINEDLDPSVGVDLLRQSKIRMFETS
FT                   QWWDELWNDILGDNPRTTVNNKAMFSILLPFLLVACLVLMARAGYSFLSGETHRIVLQQ
FT                   IVPIVLLLAFTLNYGWGAKAVAWSFREVANRGSELILDSQWAGLVVRDALKDKIHAASA
FT                   IAEYNRQSASCSRLPAITLRDPAAASSSQGLDQVQASKVQTAVRCLELLAQKLERDEAA
FT                   IKKDCPSCETAQQVIESRKKGIQADLGRISAAIFNTLNPIDDAIHGFNVVKENAVRTVS
FT                   IEGPLQIQYWFVSGQELALILSGILAPIMIIYSTLPIAGHKWAVLQYLKALVIIALVRF
FT                   AYIFVIGFGAIYLTDNPIADQGAAFATFLGYVAPAVATAAVTVGALAASGVYTGAVVTT
FT                   VGAAVTVVSSAALSASSAVTSRALRNR"
FT                   /protein_id="YP_001521481.1"
     MSVIGLTLLF IALGEVSAHA INEDLDPSVG VDLLRQSKIR MFETSQWWDE LWNDILGDNP        60
     RTTVNNKAMF SILLPFLLVA CLVLMARAGY SFLSGETHRI VLQQIVPIVL LLAFTLNYGW       120
     GAKAVAWSFR EVANRGSELI LDSQWAGLVV RDALKDKIHA ASAIAEYNRQ SASCSRLPAI       180
     TLRDPAAASS SQGLDQVQAS KVQTAVRCLE LLAQKLERDE AAIKKDCPSC ETAQQVIESR       240
     KKGIQADLGR ISAAIFNTLN PIDDAIHGFN VVKENAVRTV SIEGPLQIQY WFVSGQELAL       300
     ILSGILAPIM IIYSTLPIAG HKWAVLQYLK ALVIIALVRF AYIFVIGFGA IYLTDNPIAD       360
     QGAAFATFLG YVAPAVATAA VTVGALAASG VYTGAVVTTV GAAVTVVSSA ALSASSAVTS       420
     RALRNR                                                                  426
//

If you have problems or comments...

PBIL Back to PBIL home page