(data stored in ACNUC30567 zone)

HOGENOMDNA: ACAM1_4.PE33

ACAM1_4.PE33         Location/Qualifiers
FT   CDS             complement(33829..34980)
FT                   /locus_tag="AM1_C0033"
FT                   /gene_family="HOG000022989" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340488"
FT                   /db_xref="GeneID:5686255"
FT                   /translation="MQPKPLLITLVLSVQATITTVPAYAQVSYDDPVISGDITLPTTTA
FT                   PTTFPDVPIPTGDVTIAKDNPLDTATYTEVPTAQLPSGLLGTVFNVLGPKQKPGQARVI
FT                   NETQRKILKVYEYGQKALDAYKVGRAIYDAIDNFSLKRILSGSVSSILANYDKLGTNGT
FT                   SGSQQGGSGSEDPIYSDPQDPFQVYTQARNNEARKALLPQLMTQLVFSEDGQALIQQQG
FT                   EQVQQSVVNTIESTQALVQLSAASKEQATAGAGIATSVGETGQKAQTLKSSQAVLKSLT
FT                   AQNSLMAQGTATNGAILSNVVSGQEEQKKSSDALVVGSALAHQQRTTGLHLSASELTLQ
FT                   EQIRAELELYKDERHRAQDQAALREQLSFNYLYIPGLYSETTP"
FT                   /protein_id="YP_001521482.1"
     MQPKPLLITL VLSVQATITT VPAYAQVSYD DPVISGDITL PTTTAPTTFP DVPIPTGDVT        60
     IAKDNPLDTA TYTEVPTAQL PSGLLGTVFN VLGPKQKPGQ ARVINETQRK ILKVYEYGQK       120
     ALDAYKVGRA IYDAIDNFSL KRILSGSVSS ILANYDKLGT NGTSGSQQGG SGSEDPIYSD       180
     PQDPFQVYTQ ARNNEARKAL LPQLMTQLVF SEDGQALIQQ QGEQVQQSVV NTIESTQALV       240
     QLSAASKEQA TAGAGIATSV GETGQKAQTL KSSQAVLKSL TAQNSLMAQG TATNGAILSN       300
     VVSGQEEQKK SSDALVVGSA LAHQQRTTGL HLSASELTLQ EQIRAELELY KDERHRAQDQ       360
     AALREQLSFN YLYIPGLYSE TTP                                               383
//

If you have problems or comments...

PBIL Back to PBIL home page