(data stored in ACNUC30567 zone)

HOGENOMDNA: ACAM1_4.PE34

ACAM1_4.PE34         Location/Qualifiers
FT   CDS             complement(34970..38116)
FT                   /locus_tag="AM1_C0034"
FT                   /gene_family="HOG000022990" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340489"
FT                   /db_xref="GeneID:5686256"
FT                   /translation="MDFEAVNEGQTRDILSVNTMLDGIPVFYLGASIAVLGVGFAVLIK
FT                   FGFLLAVLFIALTSIGIILIFGRNPSQQMERVGKPTTYMDGRPSLRFDNVGMPVMAKAK
FT                   KTDPLRRIQDNFCLKTYGQFEFEGVTVGFHLHHWNSREIKIAFMFDVLGLDPTVTPAQS
FT                   KQQLNKSNQKICHLGGTDLKAILDVRADCSDPLIATATALGKATDALTTAQLQSDAENL
FT                   QSLEAEGRIAKSRLLYQAKCRMRLGGDYDTPDSPADVVFEWVSGFWNDTVAQKVMGEAY
FT                   QSKEQWEKAIFAAYTNSYRRMTRMLTGAEGLGHKIQPLTAQELFDWDYAELHEESIPIP
FT                   QYTRYDDLGLDPNPVVSEHHLHSLGVLFEPEKGKPAVPQFGESLAYLPSKGKYVGALRF
FT                   EGLRTIPEVQDSTELGFIKFLFDTLATPGELFLDARVVTELLPIKSGLTRAILEQTGRN
FT                   SIRKMGDAAQRKELNPIALERLEETKKNLEWMNNGNRPFWIAFAIFLYRDSVDQLNLDL
FT                   DALAQKLEGTKAVKITQKFEHHWCTSLAISAAPMLTLPGGGNHLYKTMSPRVLPTLPQI
FT                   HPAPMDRRGVLLIGYDLPIPFYLDLAHTFPNHTLVTGETGAGKTMLMLEMTSYCQREGM
FT                   NVVGFDFPPPTGKSSYEPYMKTQEQLNVSSTYQPVDKATINVMETPDVSWIDDLPKPGE
FT                   PGYDYQQPTHEEAWKFIKRNKLRILKAIALGEAGQSSPMEDLLIERALGLCFDAFHQAN
FT                   LERYTKASIAPFGSAEAAQMPIYEEFVAFAKSWLNQYIQDNDCGPDLQRTFENLQLLLE
FT                   GVIPTALGDSINGISSFDANVDALMLGLTNVDNDSDSLVYGVAGFDLLIRKAMNGKRTL
FT                   LPVDEGSELLTRPIFAEMVGSLANSGRKWKCNILIGMTEVKTLLNSSCSSKVISNLQNK
FT                   LVSYVNKYARELLVSEFGFQAEILKKFEHDSFKASETLQQSHWCWQRGSRQLIVTHNPS
FT                   NFTLGVGSNQGKQTEARNRVMSRYPDDPVAGLVDFGDQLSQANKQGIEVETIGVEDHAA
FT                   "
FT                   /protein_id="YP_001521483.1"
     MDFEAVNEGQ TRDILSVNTM LDGIPVFYLG ASIAVLGVGF AVLIKFGFLL AVLFIALTSI        60
     GIILIFGRNP SQQMERVGKP TTYMDGRPSL RFDNVGMPVM AKAKKTDPLR RIQDNFCLKT       120
     YGQFEFEGVT VGFHLHHWNS REIKIAFMFD VLGLDPTVTP AQSKQQLNKS NQKICHLGGT       180
     DLKAILDVRA DCSDPLIATA TALGKATDAL TTAQLQSDAE NLQSLEAEGR IAKSRLLYQA       240
     KCRMRLGGDY DTPDSPADVV FEWVSGFWND TVAQKVMGEA YQSKEQWEKA IFAAYTNSYR       300
     RMTRMLTGAE GLGHKIQPLT AQELFDWDYA ELHEESIPIP QYTRYDDLGL DPNPVVSEHH       360
     LHSLGVLFEP EKGKPAVPQF GESLAYLPSK GKYVGALRFE GLRTIPEVQD STELGFIKFL       420
     FDTLATPGEL FLDARVVTEL LPIKSGLTRA ILEQTGRNSI RKMGDAAQRK ELNPIALERL       480
     EETKKNLEWM NNGNRPFWIA FAIFLYRDSV DQLNLDLDAL AQKLEGTKAV KITQKFEHHW       540
     CTSLAISAAP MLTLPGGGNH LYKTMSPRVL PTLPQIHPAP MDRRGVLLIG YDLPIPFYLD       600
     LAHTFPNHTL VTGETGAGKT MLMLEMTSYC QREGMNVVGF DFPPPTGKSS YEPYMKTQEQ       660
     LNVSSTYQPV DKATINVMET PDVSWIDDLP KPGEPGYDYQ QPTHEEAWKF IKRNKLRILK       720
     AIALGEAGQS SPMEDLLIER ALGLCFDAFH QANLERYTKA SIAPFGSAEA AQMPIYEEFV       780
     AFAKSWLNQY IQDNDCGPDL QRTFENLQLL LEGVIPTALG DSINGISSFD ANVDALMLGL       840
     TNVDNDSDSL VYGVAGFDLL IRKAMNGKRT LLPVDEGSEL LTRPIFAEMV GSLANSGRKW       900
     KCNILIGMTE VKTLLNSSCS SKVISNLQNK LVSYVNKYAR ELLVSEFGFQ AEILKKFEHD       960
     SFKASETLQQ SHWCWQRGSR QLIVTHNPSN FTLGVGSNQG KQTEARNRVM SRYPDDPVAG      1020
     LVDFGDQLSQ ANKQGIEVET IGVEDHAA                                         1048
//

If you have problems or comments...

PBIL Back to PBIL home page