(data stored in ACNUC30567 zone)

HOGENOMDNA: ACAM1_4.PE35

ACAM1_4.PE35         Location/Qualifiers
FT   CDS             complement(38129..38680)
FT                   /locus_tag="AM1_C0035"
FT                   /gene_family="HOG000022991" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340490"
FT                   /db_xref="GeneID:5686257"
FT                   /translation="MKRLKILYEKTSKQPWWFGYSGFLIIGLIYNLPWLQATSLACLAI
FT                   TASAIAWRRIIRRSPHVLAGLQTVSITIGYQQYAQAQLNVPDSVCNGFDVIPGFGKAMI
FT                   GGLGWLNVQGFSLAGAVCGIGWLILAGVVLGAIGFAGKNSLGHSHHGGDIQEMSRPVVG
FT                   LLYFIIVMIMIGALIFAATR"
FT                   /protein_id="YP_001521484.1"
     MKRLKILYEK TSKQPWWFGY SGFLIIGLIY NLPWLQATSL ACLAITASAI AWRRIIRRSP        60
     HVLAGLQTVS ITIGYQQYAQ AQLNVPDSVC NGFDVIPGFG KAMIGGLGWL NVQGFSLAGA       120
     VCGIGWLILA GVVLGAIGFA GKNSLGHSHH GGDIQEMSRP VVGLLYFIIV MIMIGALIFA       180
     ATR                                                                     183
//

If you have problems or comments...

PBIL Back to PBIL home page