(data stored in ACNUC30567 zone)

HOGENOMDNA: ACAM1_4.PE36

ACAM1_4.PE36         Location/Qualifiers
FT   CDS             complement(38716..40809)
FT                   /locus_tag="AM1_C0036"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="RNA polymerase sigma-2 subunit"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340491"
FT                   /db_xref="GeneID:5686258"
FT                   /translation="MTTTTIASPFSDGIRLPEYLVQFLHRFPIPDPEQELDLIRKAKRG
FT                   HETSLSWLMIGHVRLVAKLAKQYAWTLDDAQDLIQEGMLGIRHAVGKFDSTKGCKFSTY
FT                   ARGWIRGYIRRFCYKNRPKQLRLPEKKQVHLDRVYRLQNEFPDANLEEIARKANLKLEY
FT                   IEDLLYWGRSFQEIPDWHEFVIDDASFYTDDEEYDEYFDIELEPETKTNLVLIKAPPPF
FT                   IPPKYQIPIHLLKQWFRVGLAQFVNAAKDQLEHTRLGFSQSFSRSSPSTAPEVGQERVN
FT                   LNTWPAPLSFCYENSINPYAYSQAPPAIESLSAKAINLVKGVIAHAQESLLVLCGGRSD
FT                   GSTDRPGHQPSPADQRCRGLGEPGTTGRGHLGFCQAVTEFIHRPLATISDCLRGFPSRA
FT                   GPDTSQQPQRGAVFDSNPPPQQMHLPRKNAMYKTIAAMIAAWLGLLISPATAETIKIAP
FT                   GHGHLIDLTASGCRVSKAYMGTRGIFDLSLDRPQPQTQKIYLTWKPNTQVKSTNLIQDL
FT                   VGCNRSSMELTINRSDSAPSTAITRIGTPTPIAHTPEQSRVFTGRLGQPPERTRVHQAS
FT                   TAVQPLTLKPQAQTLPKPKIVKRPPVRRVPLTQKVKPIPTANIPLTKTNVSDSRITPAT
FT                   LLRGLNIARASGNQTYSYLSEMHWRVNGMIRQMRWGAKADVAAKRAKISPDQLQTLLNY
FT                   AQQ"
FT                   /protein_id="YP_001521485.1"
     MTTTTIASPF SDGIRLPEYL VQFLHRFPIP DPEQELDLIR KAKRGHETSL SWLMIGHVRL        60
     VAKLAKQYAW TLDDAQDLIQ EGMLGIRHAV GKFDSTKGCK FSTYARGWIR GYIRRFCYKN       120
     RPKQLRLPEK KQVHLDRVYR LQNEFPDANL EEIARKANLK LEYIEDLLYW GRSFQEIPDW       180
     HEFVIDDASF YTDDEEYDEY FDIELEPETK TNLVLIKAPP PFIPPKYQIP IHLLKQWFRV       240
     GLAQFVNAAK DQLEHTRLGF SQSFSRSSPS TAPEVGQERV NLNTWPAPLS FCYENSINPY       300
     AYSQAPPAIE SLSAKAINLV KGVIAHAQES LLVLCGGRSD GSTDRPGHQP SPADQRCRGL       360
     GEPGTTGRGH LGFCQAVTEF IHRPLATISD CLRGFPSRAG PDTSQQPQRG AVFDSNPPPQ       420
     QMHLPRKNAM YKTIAAMIAA WLGLLISPAT AETIKIAPGH GHLIDLTASG CRVSKAYMGT       480
     RGIFDLSLDR PQPQTQKIYL TWKPNTQVKS TNLIQDLVGC NRSSMELTIN RSDSAPSTAI       540
     TRIGTPTPIA HTPEQSRVFT GRLGQPPERT RVHQASTAVQ PLTLKPQAQT LPKPKIVKRP       600
     PVRRVPLTQK VKPIPTANIP LTKTNVSDSR ITPATLLRGL NIARASGNQT YSYLSEMHWR       660
     VNGMIRQMRW GAKADVAAKR AKISPDQLQT LLNYAQQ                                697
//

If you have problems or comments...

PBIL Back to PBIL home page