(data stored in ACNUC30567 zone)

HOGENOMDNA: ACAM1_4.PE38

ACAM1_4.PE38         Location/Qualifiers
FT   CDS             complement(41050..42276)
FT                   /locus_tag="AM1_C0038"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340493"
FT                   /db_xref="GeneID:5686260"
FT                   /translation="MQVAIAKIGDATLLVTPDGKPVPHKDTEQPTFHIQPQLFNPYCDI
FT                   GLSDISLVGATIAPHDSTKPVSVLPKDVTIRQPYPNENYYVAGMAERKMGWDIPLDLDA
FT                   APKWLDLTWEVRTPSDIEHSILTIYHRFTLEFILTQQGQVFSMDQANTFYDPNARTISH
FT                   ISLNHIDDSFTKGDKSFKSYRMDSPHGLAFYQTLILNSCAWSDLICTAQEDVTLLRDIE
FT                   PAQSFQTHIDLHRQNACIEIPADVLHQAICDTQVEVDFEIGEYDRSPGLQRLCRWWNEN
FT                   APVVGTRRAAFIALWCRVEDDDWYWSGWDECPEWGVENIQRYGLQDRCARWNDFVILEF
FT                   FPRQVSRLEVAQGASTEILGVDGKGYTDTGLAREDVDEAYHAHYSLQAFPKRFPFAWKT
FT                   LQAAVHTPA"
FT                   /protein_id="YP_001521487.1"
     MQVAIAKIGD ATLLVTPDGK PVPHKDTEQP TFHIQPQLFN PYCDIGLSDI SLVGATIAPH        60
     DSTKPVSVLP KDVTIRQPYP NENYYVAGMA ERKMGWDIPL DLDAAPKWLD LTWEVRTPSD       120
     IEHSILTIYH RFTLEFILTQ QGQVFSMDQA NTFYDPNART ISHISLNHID DSFTKGDKSF       180
     KSYRMDSPHG LAFYQTLILN SCAWSDLICT AQEDVTLLRD IEPAQSFQTH IDLHRQNACI       240
     EIPADVLHQA ICDTQVEVDF EIGEYDRSPG LQRLCRWWNE NAPVVGTRRA AFIALWCRVE       300
     DDDWYWSGWD ECPEWGVENI QRYGLQDRCA RWNDFVILEF FPRQVSRLEV AQGASTEILG       360
     VDGKGYTDTG LAREDVDEAY HAHYSLQAFP KRFPFAWKTL QAAVHTPA                    408
//

If you have problems or comments...

PBIL Back to PBIL home page