(data stored in ACNUC30567 zone)

HOGENOMDNA: ACAM1_4.PE39

ACAM1_4.PE39         Location/Qualifiers
FT   CDS             complement(42364..42804)
FT                   /locus_tag="AM1_C0039"
FT                   /gene_family="HOG000022992" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340494"
FT                   /db_xref="GeneID:5686261"
FT                   /translation="MLTINTDSGKSRGGSNDLQNSDQLDPQVIQEYRERYLQIAWKVQG
FT                   LMSMPVLYTYDQLYRHGCDHPKLSERIDALVSLELRLSGYSKDDQVNILLYGPYIQAQM
FT                   LDHSMSESGARDYIRQRLAIAPTPPAPLKELSQIQVAPTTAA"
FT                   /protein_id="YP_001521488.1"
     MLTINTDSGK SRGGSNDLQN SDQLDPQVIQ EYRERYLQIA WKVQGLMSMP VLYTYDQLYR        60
     HGCDHPKLSE RIDALVSLEL RLSGYSKDDQ VNILLYGPYI QAQMLDHSMS ESGARDYIRQ       120
     RLAIAPTPPA PLKELSQIQV APTTAA                                            146
//

If you have problems or comments...

PBIL Back to PBIL home page