(data stored in ACNUC30567 zone)

HOGENOMDNA: ACAM1_4.PE4

ACAM1_4.PE4          Location/Qualifiers
FT   CDS             complement(1457..1954)
FT                   /locus_tag="AM1_C0004"
FT                   /gene_family="HOG000291291" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="rod shape-determining-related protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340459"
FT                   /db_xref="GeneID:5686226"
FT                   /translation="MNLVQRLMGIFSEDLLIELTKSEVSITSFTSGATVKDKPLIAVSG
FT                   EKNKLTVEGVGAECQNMSKPGLQLINPFDHSRSFVANFTYAEKILQYLIRKLLRNRLIT
FT                   SPRVIIHQLEKNEGGLTEIEERVLRELALGAGAREVIVFQGSKINTNVDTYQTIKQRFD
FT                   AT"
FT                   /protein_id="YP_001521453.1"
     MNLVQRLMGI FSEDLLIELT KSEVSITSFT SGATVKDKPL IAVSGEKNKL TVEGVGAECQ        60
     NMSKPGLQLI NPFDHSRSFV ANFTYAEKIL QYLIRKLLRN RLITSPRVII HQLEKNEGGL       120
     TEIEERVLRE LALGAGAREV IVFQGSKINT NVDTYQTIKQ RFDAT                       165
//

If you have problems or comments...

PBIL Back to PBIL home page