(data stored in ACNUC30567 zone)

HOGENOMDNA: ACAM1_4.PE40

ACAM1_4.PE40         Location/Qualifiers
FT   CDS             complement(43387..46911)
FT                   /locus_tag="AM1_C0040"
FT                   /gene_family="HOG000023186" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340495"
FT                   /db_xref="GeneID:5686262"
FT                   /translation="MSSFQNISSKLLATNRSNPCDLCGDITGKCRKAGNLNLCMTLSGK
FT                   IEGYRYLGQSKDGLWGKYVLDDGEDLSQEDWERRWQEQRILREQRAQVEAQRHAQSLPA
FT                   IERDRLYRQLLDQLTLHPADRADLHRRGFTNEQIQDWGVKSVEQWQPLSGELPHDLPGI
FT                   NLDGKSLNTPRPGYLCPIMDADGQIVGFQIRSRSSEGGRYFWLTGKTRKRPNGPTPHLR
FT                   NGELPLAIHRPEQITRDAFALVEGTGAKPHLLAQRMGQVTIGAAGGLFAASPETLKATL
FT                   AQLGITTIEFYPDAGAIQNKSVLRQYRSTWALLKEWGYTVTVAWWKQTDKRIHTDIDEL
FT                   DDLSQIQYLSVADFERIAAQCNGLLHQLQQALSKLTRPSSPAQGFATPNDQQTHPTESR
FT                   RTKRTAPDEERLATLPATSRRARRSRRRTARLLAAHRRHGYISKLRLENYRSRIRRRTA
FT                   QSANSRSSSLQSCPGDNGTLSPTTPLVHEYQPGQRLQTWETLISSGFPYILDQSQPGTG
FT                   KSYDSGNVTPIGFGMEQVIYLSDQHRNPTVSTLEQGNGWCDLEARHGGLNRVKNRLQRS
FT                   AKGDAFAVPANCSRIGVLNALRDKNIPGADTANLICGTCIAREACINADGPGYGFLNQR
FT                   RNVLGTPLLRAHPDSLPDPEDYPLENTMLIWDEPGQNFQVKQSVTVTFNDLQQTISGLI
FT                   AYPEIFALVQPLLSALLPLMDGSEKLGKYGLNHLEMKAKLPDMAGVKLGELTQVLMPNL
FT                   GFLNTTSDYGVDLADLPKQLRKKFSERDSEMAEQARNGVVKQWLIPLIRILQGGAGCIQ
FT                   VSRYGLLTLNTPNPRHRDLAQAAQANVFLDATLSREDLALKLGCSPDEILVVRQAVPDT
FT                   GNLEVIQVKDMGRVGMSRGGDQTKRIGALAQHYQDLDAVNTRTIDFKKFEKDGAWWRDS
FT                   RGVNDFLTVQTLVLVGTPCRNLNDLAAEFAIVCGYYPEEDNPAFTAFIDRSILAEIHQA
FT                   IGRLRAHRRPHESLQVVLISNIEMDCFVQEVQAKELTLDAAHKTERVEIAIESAILQLQ
FT                   AKGEKVTQQIVSAMTQIPRGTIARYWRLFISLLKGLNSKMNNLCNAPNPNQETHQAIAG
FT                   VLDELADLPVNDLLPSLNEVFFDWLKPKEWSSVWSEVSASGQMAILEGLAMTLPVKMLE
FT                   RGMPELAA"
FT                   /protein_id="YP_001521489.1"
     MSSFQNISSK LLATNRSNPC DLCGDITGKC RKAGNLNLCM TLSGKIEGYR YLGQSKDGLW        60
     GKYVLDDGED LSQEDWERRW QEQRILREQR AQVEAQRHAQ SLPAIERDRL YRQLLDQLTL       120
     HPADRADLHR RGFTNEQIQD WGVKSVEQWQ PLSGELPHDL PGINLDGKSL NTPRPGYLCP       180
     IMDADGQIVG FQIRSRSSEG GRYFWLTGKT RKRPNGPTPH LRNGELPLAI HRPEQITRDA       240
     FALVEGTGAK PHLLAQRMGQ VTIGAAGGLF AASPETLKAT LAQLGITTIE FYPDAGAIQN       300
     KSVLRQYRST WALLKEWGYT VTVAWWKQTD KRIHTDIDEL DDLSQIQYLS VADFERIAAQ       360
     CNGLLHQLQQ ALSKLTRPSS PAQGFATPND QQTHPTESRR TKRTAPDEER LATLPATSRR       420
     ARRSRRRTAR LLAAHRRHGY ISKLRLENYR SRIRRRTAQS ANSRSSSLQS CPGDNGTLSP       480
     TTPLVHEYQP GQRLQTWETL ISSGFPYILD QSQPGTGKSY DSGNVTPIGF GMEQVIYLSD       540
     QHRNPTVSTL EQGNGWCDLE ARHGGLNRVK NRLQRSAKGD AFAVPANCSR IGVLNALRDK       600
     NIPGADTANL ICGTCIAREA CINADGPGYG FLNQRRNVLG TPLLRAHPDS LPDPEDYPLE       660
     NTMLIWDEPG QNFQVKQSVT VTFNDLQQTI SGLIAYPEIF ALVQPLLSAL LPLMDGSEKL       720
     GKYGLNHLEM KAKLPDMAGV KLGELTQVLM PNLGFLNTTS DYGVDLADLP KQLRKKFSER       780
     DSEMAEQARN GVVKQWLIPL IRILQGGAGC IQVSRYGLLT LNTPNPRHRD LAQAAQANVF       840
     LDATLSREDL ALKLGCSPDE ILVVRQAVPD TGNLEVIQVK DMGRVGMSRG GDQTKRIGAL       900
     AQHYQDLDAV NTRTIDFKKF EKDGAWWRDS RGVNDFLTVQ TLVLVGTPCR NLNDLAAEFA       960
     IVCGYYPEED NPAFTAFIDR SILAEIHQAI GRLRAHRRPH ESLQVVLISN IEMDCFVQEV      1020
     QAKELTLDAA HKTERVEIAI ESAILQLQAK GEKVTQQIVS AMTQIPRGTI ARYWRLFISL      1080
     LKGLNSKMNN LCNAPNPNQE THQAIAGVLD ELADLPVNDL LPSLNEVFFD WLKPKEWSSV      1140
     WSEVSASGQM AILEGLAMTL PVKMLERGMP ELAA                                  1174
//

If you have problems or comments...

PBIL Back to PBIL home page