(data stored in ACNUC30567 zone)

HOGENOMDNA: ACAM1_4.PE41

ACAM1_4.PE41         Location/Qualifiers
FT   CDS             complement(47591..48616)
FT                   /locus_tag="AM1_C0041"
FT                   /gene_family="HOG000022994" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340496"
FT                   /db_xref="GeneID:5686263"
FT                   /translation="MDGGTQPRAQLFEEVVAEYAEDMKQGAIFPPVIVYYDGEEYWLAD
FT                   GFHRVRARETIGSKDVTADVRLGTQRDAVLYAVGANAAHGLRRTNADKHRAVKRLLRDK
FT                   EWMKWSDREIARRCGVANSFVGRIRKSLSVPEEQINHDAEGLDLDPSVRLAKRGGTIFE
FT                   MDTTNIRDRPQTEQKKSIKRSRAKKQPVSPKPLEGKPIEVKEGDTWKLGKSHYLFCGEG
FT                   SSRKFLKLFPPEVALLLYFPRQREDWTQAITLQARSTLLFHTFYGEDIDLKNLRKIIEN
FT                   CLSTTTDADDSIVVINLADPLLFILMESLFCSCYCAEPDPQRCTDALAAWAAIKQPVKK
FT                   L"
FT                   /protein_id="YP_001521490.1"
     MDGGTQPRAQ LFEEVVAEYA EDMKQGAIFP PVIVYYDGEE YWLADGFHRV RARETIGSKD        60
     VTADVRLGTQ RDAVLYAVGA NAAHGLRRTN ADKHRAVKRL LRDKEWMKWS DREIARRCGV       120
     ANSFVGRIRK SLSVPEEQIN HDAEGLDLDP SVRLAKRGGT IFEMDTTNIR DRPQTEQKKS       180
     IKRSRAKKQP VSPKPLEGKP IEVKEGDTWK LGKSHYLFCG EGSSRKFLKL FPPEVALLLY       240
     FPRQREDWTQ AITLQARSTL LFHTFYGEDI DLKNLRKIIE NCLSTTTDAD DSIVVINLAD       300
     PLLFILMESL FCSCYCAEPD PQRCTDALAA WAAIKQPVKK L                           341
//

If you have problems or comments...

PBIL Back to PBIL home page