(data stored in ACNUC30567 zone)

HOGENOMDNA: ACAM1_4.PE42

ACAM1_4.PE42         Location/Qualifiers
FT   CDS             complement(48768..49229)
FT                   /locus_tag="AM1_C0042"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340497"
FT                   /db_xref="GeneID:5686264"
FT                   /translation="MSYSKVDNSFTNLKLSDITLDNEIQSYQQLIQEVVGEFAEAMRQG
FT                   AKFPPVVVFFDGDNYWLADGLHRFLAKQFVAEQSISTEVQPGSRYDANFYSARSNLNPS
FT                   DIHSSEEKHRFFENILYDGQSEPLQYLDQSPNRSRRKRGQTIATNIRTL"
FT                   /protein_id="YP_001521491.1"
     MSYSKVDNSF TNLKLSDITL DNEIQSYQQL IQEVVGEFAE AMRQGAKFPP VVVFFDGDNY        60
     WLADGLHRFL AKQFVAEQSI STEVQPGSRY DANFYSARSN LNPSDIHSSE EKHRFFENIL       120
     YDGQSEPLQY LDQSPNRSRR KRGQTIATNI RTL                                    153
//

If you have problems or comments...

PBIL Back to PBIL home page