(data stored in ACNUC30567 zone)

HOGENOMDNA: ACAM1_4.PE43

ACAM1_4.PE43         Location/Qualifiers
FT   CDS             49780..50832
FT                   /locus_tag="AM1_C0043"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340498"
FT                   /db_xref="GeneID:5686265"
FT                   /translation="MDKEWDLQRLYSDLEMVNKQSLSNSAKQYLEYILLGQSPSNIAET
FT                   LNPESRQSSGTIRTVLSRDVYPSLILLLNLPEDYRMRWNKVPMLLSQYKIAKREACSSS
FT                   PSYIHYEKNQNSYVGSCQIKSDIINGLLKKYFLKKGFTEDFLSSNTKSMSFRSEWQTIV
FT                   NKLVSETRETLLAMVLDTELKKWWSSIAGMMYMATNVNLLKNGVKIKRIFILNSLDFRI
FT                   RNNAIMNAYLHEKMGVEVKILDNIDCKIKMFIDADMISVHDKELIALYYLSEDCEITEL
FT                   LLDYCSISAFSSFYDELFDDDRLCENVDKIISNSNLSSSFFSDIEHQINYLKRISCSTS
FT                   VKEFLGILPN"
FT                   /protein_id="YP_001521492.1"
     MDKEWDLQRL YSDLEMVNKQ SLSNSAKQYL EYILLGQSPS NIAETLNPES RQSSGTIRTV        60
     LSRDVYPSLI LLLNLPEDYR MRWNKVPMLL SQYKIAKREA CSSSPSYIHY EKNQNSYVGS       120
     CQIKSDIING LLKKYFLKKG FTEDFLSSNT KSMSFRSEWQ TIVNKLVSET RETLLAMVLD       180
     TELKKWWSSI AGMMYMATNV NLLKNGVKIK RIFILNSLDF RIRNNAIMNA YLHEKMGVEV       240
     KILDNIDCKI KMFIDADMIS VHDKELIALY YLSEDCEITE LLLDYCSISA FSSFYDELFD       300
     DDRLCENVDK IISNSNLSSS FFSDIEHQIN YLKRISCSTS VKEFLGILPN                  350
//

If you have problems or comments...

PBIL Back to PBIL home page