(data stored in ACNUC30567 zone)

HOGENOMDNA: ACAM1_4.PE44

ACAM1_4.PE44         Location/Qualifiers
FT   CDS             50837..51295
FT                   /locus_tag="AM1_C0044"
FT                   /gene_family="HOG000014565" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340499"
FT                   /db_xref="GeneID:5686266"
FT                   /translation="MKSTELKTGRTFGVTFEHQSDFFQELSSFCKENQVQQGYIPMFIA
FT                   GFSEVELVGTCSKIDDVNAPVWDKVHLSNVEACGCGTIAYDSDEDKISPHIHVNTGIKS
FT                   YSASGHTSHLLSAKVLFLVEMLIVEVLQPDMRRVVDPNLYNIGLLQFI"
FT                   /protein_id="YP_001521493.1"
     MKSTELKTGR TFGVTFEHQS DFFQELSSFC KENQVQQGYI PMFIAGFSEV ELVGTCSKID        60
     DVNAPVWDKV HLSNVEACGC GTIAYDSDED KISPHIHVNT GIKSYSASGH TSHLLSAKVL       120
     FLVEMLIVEV LQPDMRRVVD PNLYNIGLLQ FI                                     152
//

If you have problems or comments...

PBIL Back to PBIL home page