(data stored in ACNUC30567 zone)

HOGENOMDNA: ACAM1_4.PE45

ACAM1_4.PE45         Location/Qualifiers
FT   CDS             51334..52143
FT                   /locus_tag="AM1_C0045"
FT                   /gene_family="HOG000222700" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="carbon-nitrogen hydrolase family protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340500"
FT                   /db_xref="GeneID:5686267"
FT                   /translation="MKVGFIQFSPILGKPTQTLERLEYLIDKGKHSDILVLPELCNSGY
FT                   AFNSRQQALNSSESVADSKFIRFLHEKSNKYNLYIVSGFCEKSDKDLYNSSFLVGPNEY
FT                   IEVYRKSHLFLNEKDFFSPGNTDYSVYDIGICKIGMLICFDWVFPEAWRILALKGADII
FT                   CHPSNIVLPDLCQKTIPGHSICNRMFIVTANRIGTEDNLTFTGSSIICDPRGNILTQAS
FT                   DDQEEVMISDIDLNLARDKSITSRNHIFLDRRPDKYLDIAKAIEESV"
FT                   /protein_id="YP_001521494.1"
     MKVGFIQFSP ILGKPTQTLE RLEYLIDKGK HSDILVLPEL CNSGYAFNSR QQALNSSESV        60
     ADSKFIRFLH EKSNKYNLYI VSGFCEKSDK DLYNSSFLVG PNEYIEVYRK SHLFLNEKDF       120
     FSPGNTDYSV YDIGICKIGM LICFDWVFPE AWRILALKGA DIICHPSNIV LPDLCQKTIP       180
     GHSICNRMFI VTANRIGTED NLTFTGSSII CDPRGNILTQ ASDDQEEVMI SDIDLNLARD       240
     KSITSRNHIF LDRRPDKYLD IAKAIEESV                                         269
//

If you have problems or comments...

PBIL Back to PBIL home page