(data stored in ACNUC30567 zone)

HOGENOMDNA: ACAM1_4.PE46

ACAM1_4.PE46         Location/Qualifiers
FT   CDS             complement(52244..52558)
FT                   /locus_tag="AM1_C0046"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="single-stranded DNA-binding protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340501"
FT                   /db_xref="GeneID:5686268"
FT                   /translation="MNTCTFQGILLERSLRYTQERRAIAEFVVEINPLMEEDPKENLKA
FT                   IYWGENGEQAHNALQAGDQLVLQGQLRINKVTHRLGNEEYVEQQASVIVEKINRIQSPG
FT                   "
FT                   /protein_id="YP_001521495.1"
     MNTCTFQGIL LERSLRYTQE RRAIAEFVVE INPLMEEDPK ENLKAIYWGE NGEQAHNALQ        60
     AGDQLVLQGQ LRINKVTHRL GNEEYVEQQA SVIVEKINRI QSPG                        104
//

If you have problems or comments...

PBIL Back to PBIL home page