(data stored in ACNUC30567 zone)

HOGENOMDNA: ACAM1_4.PE47

ACAM1_4.PE47         Location/Qualifiers
FT   CDS             52684..53505
FT                   /locus_tag="AM1_C0047"
FT                   /gene_family="HOG000022995" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340502"
FT                   /db_xref="GeneID:5686269"
FT                   /translation="MPSATIDKLNQLKVQLKQCNNDTAALLLKRTIAKLESQLQREQLT
FT                   TQSAKIPSKEIPKVSQAIFKQQSLVQDKKVVPQQQQITKNLQAKSKQRNHRKKRRPLLP
FT                   GNGTHRAWCRIPGIIRVQEVEGEGEQPVYFIELDGHQLPLRVKKRFSKLIGASLDTPLM
FT                   VKCYPQIIEGQIVFLQFCGAAEPTPETPEDWVMIGVWNSENQRVLVQRDQRCDQSRRIL
FT                   QHSPLVKEACLEKLEAGKLYRYQCQREGITVTIVGVEVVEGEEGKIVQEAS"
FT                   /protein_id="YP_001521496.1"
     MPSATIDKLN QLKVQLKQCN NDTAALLLKR TIAKLESQLQ REQLTTQSAK IPSKEIPKVS        60
     QAIFKQQSLV QDKKVVPQQQ QITKNLQAKS KQRNHRKKRR PLLPGNGTHR AWCRIPGIIR       120
     VQEVEGEGEQ PVYFIELDGH QLPLRVKKRF SKLIGASLDT PLMVKCYPQI IEGQIVFLQF       180
     CGAAEPTPET PEDWVMIGVW NSENQRVLVQ RDQRCDQSRR ILQHSPLVKE ACLEKLEAGK       240
     LYRYQCQREG ITVTIVGVEV VEGEEGKIVQ EAS                                    273
//

If you have problems or comments...

PBIL Back to PBIL home page