(data stored in ACNUC30567 zone)

HOGENOMDNA: ACAM1_4.PE48

ACAM1_4.PE48         Location/Qualifiers
FT   CDS             complement(53557..53802)
FT                   /locus_tag="AM1_C0048"
FT                   /gene_family="HOG000276232" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="RNA-binding protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340503"
FT                   /db_xref="GeneID:5686270"
FT                   /translation="MRPLVQQDLNAVFAEYGTVKQVKMPTDRETGRKRGFAFVEMGNDA
FT                   EEAKAIDELEGAELMGRTLKVNKARPHENRGGGNRW"
FT                   /protein_id="YP_001521497.1"
     MRPLVQQDLN AVFAEYGTVK QVKMPTDRET GRKRGFAFVE MGNDAEEAKA IDELEGAELM        60
     GRTLKVNKAR PHENRGGGNR W                                                  81
//

If you have problems or comments...

PBIL Back to PBIL home page