(data stored in ACNUC30567 zone)

HOGENOMDNA: ACAM1_4.PE5

ACAM1_4.PE5          Location/Qualifiers
FT   CDS             complement(2064..2267)
FT                   /locus_tag="AM1_C0005"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340460"
FT                   /db_xref="GeneID:5686227"
FT                   /translation="MAMPEMCSGSRNPTDSGVTEEVANYEYVARTGVQVYIPELNDCDE
FT                   TLSLGSYLVTFPKALKLEEYCV"
FT                   /protein_id="YP_001521454.1"
     MAMPEMCSGS RNPTDSGVTE EVANYEYVAR TGVQVYIPEL NDCDETLSLG SYLVTFPKAL        60
     KLEEYCV                                                                  67
//

If you have problems or comments...

PBIL Back to PBIL home page