(data stored in ACNUC30567 zone)

HOGENOMDNA: ACAM1_4.PE50

ACAM1_4.PE50         Location/Qualifiers
FT   CDS             54103..54990
FT                   /locus_tag="AM1_C0050"
FT                   /gene_family="HOG000244136" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="methylated DNA-protein cysteine
FT                   methyltransferase"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340505"
FT                   /db_xref="GeneID:5686272"
FT                   /translation="MGLRRLTPEDDPSDHYQMVAAAIAFIREHRFEQPALSTVAQHIGL
FT                   SEYHFQRLFTYWAGISPKRFLQYLTIEQAKATIAQTDSLLTLSEDLGLSGPSRLHDLFV
FT                   SIEAMSPGEYKNGGEGLEIYNGSHNTLFGTVVIATTKRGICSLQFQDKATLPVDDLLTN
FT                   TWPNATLTVDQEKTQGLCDRIFLPEMSQPTKPLTLLVKGTNFQVQVWRALLQIPLGGLT
FT                   TYQTIAEMIERPKAARAVGTAIGKNPIGYLIPCHRVIRGSGEIGGYSWGLDRKQAILGW
FT                   EAAQLNHSTIQEGS"
FT                   /protein_id="YP_001521499.1"
     MGLRRLTPED DPSDHYQMVA AAIAFIREHR FEQPALSTVA QHIGLSEYHF QRLFTYWAGI        60
     SPKRFLQYLT IEQAKATIAQ TDSLLTLSED LGLSGPSRLH DLFVSIEAMS PGEYKNGGEG       120
     LEIYNGSHNT LFGTVVIATT KRGICSLQFQ DKATLPVDDL LTNTWPNATL TVDQEKTQGL       180
     CDRIFLPEMS QPTKPLTLLV KGTNFQVQVW RALLQIPLGG LTTYQTIAEM IERPKAARAV       240
     GTAIGKNPIG YLIPCHRVIR GSGEIGGYSW GLDRKQAILG WEAAQLNHST IQEGS            295
//

If you have problems or comments...

PBIL Back to PBIL home page