(data stored in ACNUC30567 zone)

HOGENOMDNA: ACAM1_4.PE51

ACAM1_4.PE51         Location/Qualifiers
FT   CDS             54990..55871
FT                   /locus_tag="AM1_C0051"
FT                   /gene_family="HOG000253120" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340506"
FT                   /db_xref="GeneID:5686273"
FT                   /translation="MRLSDVLELLLLSALWGGSFLFMRIAAPVLGPIWLIECRVLFAGL
FT                   ALLPLLLRSQAWSMICANLKSLFIVGSINSALPFLLLAFASLSLPAGYTSIVNATAPLF
FT                   GTLIATTWLHEKLTAARMVGLLSGFAGVVLLIGLQPMEITPVVIGSIVAGLLAAIMYAI
FT                   AAPFAKRRLSGIPPLVIATMTQLSAAVALLPLLPFTLPAAMPSTTIMLAVLALAFFSTS
FT                   LAYLLYFRLIQNIGASKALTVTYLVPIFAVLWGAVFLREAITVAMISGCCLILLGTAIA
FT                   NGLLFSASQRNL"
FT                   /protein_id="YP_001521500.1"
     MRLSDVLELL LLSALWGGSF LFMRIAAPVL GPIWLIECRV LFAGLALLPL LLRSQAWSMI        60
     CANLKSLFIV GSINSALPFL LLAFASLSLP AGYTSIVNAT APLFGTLIAT TWLHEKLTAA       120
     RMVGLLSGFA GVVLLIGLQP MEITPVVIGS IVAGLLAAIM YAIAAPFAKR RLSGIPPLVI       180
     ATMTQLSAAV ALLPLLPFTL PAAMPSTTIM LAVLALAFFS TSLAYLLYFR LIQNIGASKA       240
     LTVTYLVPIF AVLWGAVFLR EAITVAMISG CCLILLGTAI ANGLLFSASQ RNL              293
//

If you have problems or comments...

PBIL Back to PBIL home page