(data stored in ACNUC30567 zone)

HOGENOMDNA: ACAM1_4.PE53

ACAM1_4.PE53         Location/Qualifiers
FT   CDS             57058..57591
FT                   /locus_tag="AM1_C0053"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340508"
FT                   /db_xref="GeneID:5686275"
FT                   /translation="MKYTTNKTEASNTETLSSDELKAALAESERIGRQIYTGFNERKLD
FT                   LWDDVIASDVQLRSTVGDQPQYGLEALKNWTAEFHKAFQPRLDLVDEIYGVNRATIAVN
FT                   LIWQHVDEFFGLAPTGRKGTSIEYFILTHAEGKVTHYWVADHSLDLASYLTHERGLHYP
FT                   QNFEPEPIIRGIDF"
FT                   /protein_id="YP_001521502.1"
     MKYTTNKTEA SNTETLSSDE LKAALAESER IGRQIYTGFN ERKLDLWDDV IASDVQLRST        60
     VGDQPQYGLE ALKNWTAEFH KAFQPRLDLV DEIYGVNRAT IAVNLIWQHV DEFFGLAPTG       120
     RKGTSIEYFI LTHAEGKVTH YWVADHSLDL ASYLTHERGL HYPQNFEPEP IIRGIDF          177
//

If you have problems or comments...

PBIL Back to PBIL home page