(data stored in ACNUC30567 zone)

HOGENOMDNA: ACAM1_4.PE54

ACAM1_4.PE54         Location/Qualifiers
FT   CDS             57675..58619
FT                   /locus_tag="AM1_C0054"
FT                   /gene_family="HOG000294678" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="oxidoreductase, zinc-binding dehydrogenase family
FT                   protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340509"
FT                   /db_xref="GeneID:5686276"
FT                   /translation="MQRIIMNSDQEGGLSFVETDSLQPLPHQSLIKVTAFSLNRGEINI
FT                   AQSPTSGGRSIGWDFVGVIENSAADGTGLKKGTRVVGWRPEMDAFAEYVIGEHQFIAPI
FT                   PDAVSDVQAATLPVAGLTALAAVDQGNRLVGNSALVTGVTGGVGYFALQLAKLSGARTV
FT                   AQVRRSEQATFASNIGADAVVVTEDGSGLEGEGPYHLVVDGVGGQLFSSLLSVTAKGGT
FT                   LVSYGSSESHESTVNLYPALFGNGGQRRIYGLTLYSEIEKEPSSAALTRLLNLVERDLL
FT                   KLPETITSDWSETPHLAEDLLARKFTGKAVLTL"
FT                   /protein_id="YP_001521503.1"
     MQRIIMNSDQ EGGLSFVETD SLQPLPHQSL IKVTAFSLNR GEINIAQSPT SGGRSIGWDF        60
     VGVIENSAAD GTGLKKGTRV VGWRPEMDAF AEYVIGEHQF IAPIPDAVSD VQAATLPVAG       120
     LTALAAVDQG NRLVGNSALV TGVTGGVGYF ALQLAKLSGA RTVAQVRRSE QATFASNIGA       180
     DAVVVTEDGS GLEGEGPYHL VVDGVGGQLF SSLLSVTAKG GTLVSYGSSE SHESTVNLYP       240
     ALFGNGGQRR IYGLTLYSEI EKEPSSAALT RLLNLVERDL LKLPETITSD WSETPHLAED       300
     LLARKFTGKA VLTL                                                         314
//

If you have problems or comments...

PBIL Back to PBIL home page