(data stored in ACNUC30567 zone)

HOGENOMDNA: ACAM1_4.PE56

ACAM1_4.PE56         Location/Qualifiers
FT   CDS             59946..60371
FT                   /locus_tag="AM1_C0056"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340511"
FT                   /db_xref="GeneID:5686278"
FT                   /translation="MEQTNVETVQKFFEAHYAGDFDRAFQAYAQPNFQWIVSSSSNESL
FT                   RAAIPWAGYTHQGKEGYIRLVTLLFSEFEVLTFEPSRYTDAGDRVFVEGHFTFRHRQTG
FT                   KIADSDWLARFDMEDGRITGGQFYENTVGVAEARRAA"
FT                   /protein_id="YP_001521505.1"
     MEQTNVETVQ KFFEAHYAGD FDRAFQAYAQ PNFQWIVSSS SNESLRAAIP WAGYTHQGKE        60
     GYIRLVTLLF SEFEVLTFEP SRYTDAGDRV FVEGHFTFRH RQTGKIADSD WLARFDMEDG       120
     RITGGQFYEN TVGVAEARRA A                                                 141
//

If you have problems or comments...

PBIL Back to PBIL home page