(data stored in ACNUC30567 zone)

HOGENOMDNA: ACAM1_4.PE59

ACAM1_4.PE59         Location/Qualifiers
FT   CDS             62567..63160
FT                   /locus_tag="AM1_C0059"
FT                   /gene_family="HOG000218410" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340514"
FT                   /db_xref="GeneID:5686281"
FT                   /translation="MSLNSYSCETELMDFKIYTLETAPDESKGALQQAEQTFKFIPNLE
FT                   GILAESPATLKSGMALWDLFETTSFTPIEQQVIYLTANYEHECSYCVAAHSGLAKMVGM
FT                   SAEDIEAIRNGKPLIDQKLQALRHFTKRMISERGWVGDEEIEEFLAAGYTRQQILEVIL
FT                   GIAVKVIHNYTNHIAKTPLDKAFQPYTWSKPSVP"
FT                   /protein_id="YP_001521508.1"
     MSLNSYSCET ELMDFKIYTL ETAPDESKGA LQQAEQTFKF IPNLEGILAE SPATLKSGMA        60
     LWDLFETTSF TPIEQQVIYL TANYEHECSY CVAAHSGLAK MVGMSAEDIE AIRNGKPLID       120
     QKLQALRHFT KRMISERGWV GDEEIEEFLA AGYTRQQILE VILGIAVKVI HNYTNHIAKT       180
     PLDKAFQPYT WSKPSVP                                                      197
//

If you have problems or comments...

PBIL Back to PBIL home page