(data stored in ACNUC30567 zone)

HOGENOMDNA: ACAM1_4.PE60

ACAM1_4.PE60         Location/Qualifiers
FT   CDS             complement(63505..64326)
FT                   /locus_tag="AM1_C0060"
FT                   /gene_family="HOG000075379" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="glycosyl transferase, WecB/TagA/CpsF family
FT                   protein, putative"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340515"
FT                   /db_xref="GeneID:5686282"
FT                   /translation="MKESMEMLAKDPNSELFSTDIEPLRIDVIGSLITAAPIDVLVNVI
FT                   LVWAKQHKSKMVCIANTHMLVDAHQKPSFGEVLKDSDIVTPNAMPLVWLLKRMGVKTQE
FT                   IVTSLNLMQCLCQKASQQKVSIFFLGSQSLILQKMRHRLAQDFPELLIAGMEPLPIRPL
FT                   TLDQRQKLIQRIKHSGAGLVMVAYSSPKQEYWMAEHKNQIEAVMIGVGGAFPAYAGLNS
FT                   SVPTWMKEIGFEWIYRFFQEPTKFWKKHVKTTSIFIHLALNQIWNRYFELR"
FT                   /protein_id="YP_001521509.1"
     MKESMEMLAK DPNSELFSTD IEPLRIDVIG SLITAAPIDV LVNVILVWAK QHKSKMVCIA        60
     NTHMLVDAHQ KPSFGEVLKD SDIVTPNAMP LVWLLKRMGV KTQEIVTSLN LMQCLCQKAS       120
     QQKVSIFFLG SQSLILQKMR HRLAQDFPEL LIAGMEPLPI RPLTLDQRQK LIQRIKHSGA       180
     GLVMVAYSSP KQEYWMAEHK NQIEAVMIGV GGAFPAYAGL NSSVPTWMKE IGFEWIYRFF       240
     QEPTKFWKKH VKTTSIFIHL ALNQIWNRYF ELR                                    273
//

If you have problems or comments...

PBIL Back to PBIL home page