(data stored in ACNUC30567 zone)

HOGENOMDNA: ACAM1_4.PE61

ACAM1_4.PE61         Location/Qualifiers
FT   CDS             65300..65512
FT                   /locus_tag="AM1_C0061"
FT                   /gene_family="HOG000232690" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340516"
FT                   /db_xref="GeneID:5686283"
FT                   /translation="MSTTISILADIPEELHETLINYLEDHPDWDQDRVFSAALSLFLMQ
FT                   YGQSDRRTARVYLDSLFKKDLPTAC"
FT                   /protein_id="YP_001521510.1"
     MSTTISILAD IPEELHETLI NYLEDHPDWD QDRVFSAALS LFLMQYGQSD RRTARVYLDS        60
     LFKKDLPTAC                                                               70
//

If you have problems or comments...

PBIL Back to PBIL home page