(data stored in ACNUC30567 zone)

HOGENOMDNA: ACAM1_4.PE62

ACAM1_4.PE62         Location/Qualifiers
FT   CDS             65512..65946
FT                   /locus_tag="AM1_C0062"
FT                   /gene_family="HOG000022996" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340517"
FT                   /db_xref="GeneID:5686284"
FT                   /translation="MPTPQPISSLTIHLTPEHLGFLAYLYPKEDPEDALIKLLDSARTR
FT                   AIRRAEQQVRVLHLDQEQAEDQEEDPEESVSLSADVVENPIGALQELCQRQQISMPRYE
FT                   FEVIPEGFRCLVLAMGLRGVGEGRSKKQAKVMAGHCSFKK"
FT                   /protein_id="YP_001521511.1"
     MPTPQPISSL TIHLTPEHLG FLAYLYPKED PEDALIKLLD SARTRAIRRA EQQVRVLHLD        60
     QEQAEDQEED PEESVSLSAD VVENPIGALQ ELCQRQQISM PRYEFEVIPE GFRCLVLAMG       120
     LRGVGEGRSK KQAKVMAGHC SFKK                                              144
//

If you have problems or comments...

PBIL Back to PBIL home page