(data stored in ACNUC30567 zone)

HOGENOMDNA: ACAM1_4.PE64

ACAM1_4.PE64         Location/Qualifiers
FT   CDS             66314..66979
FT                   /locus_tag="AM1_C0064"
FT                   /gene_family="HOG000023193" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340519"
FT                   /db_xref="GeneID:5686286"
FT                   /translation="MKCTPAWVKIFPPWLSEGWTIHFIDRESRYWFEARAGLKDESLFE
FT                   KSVKAAWDWAKPSSSIRWFTDGERRYSKVLWKLASAYLPRSTTTQAYPFRKIWRAGLEV
FT                   AMKLKGSQGKPRVVWVNREHPYTAISPKSDVHANHLEALHSSLRRRASSYRRRQNHYAK
FT                   TVEGLQRALNVQRLIHNWCRSHYSHGYQRTPAMVMGFIQRPVKIGEVLTVRAFECLTS"
FT                   /protein_id="YP_001521513.1"
     MKCTPAWVKI FPPWLSEGWT IHFIDRESRY WFEARAGLKD ESLFEKSVKA AWDWAKPSSS        60
     IRWFTDGERR YSKVLWKLAS AYLPRSTTTQ AYPFRKIWRA GLEVAMKLKG SQGKPRVVWV       120
     NREHPYTAIS PKSDVHANHL EALHSSLRRR ASSYRRRQNH YAKTVEGLQR ALNVQRLIHN       180
     WCRSHYSHGY QRTPAMVMGF IQRPVKIGEV LTVRAFECLT S                           221
//

If you have problems or comments...

PBIL Back to PBIL home page