(data stored in ACNUC30567 zone)

HOGENOMDNA: ACAM1_4.PE65

ACAM1_4.PE65         Location/Qualifiers
FT   CDS             67480..68097
FT                   /locus_tag="AM1_C0065"
FT                   /gene_family="HOG000022997" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340520"
FT                   /db_xref="GeneID:5686287"
FT                   /translation="MTPPIVALNPKPIPQTIPQLPKSVPSSLKLVSRTAFPKETPEGTR
FT                   PPKREQGYGELGGIRRSSRRASQTTRLKKVPHSTSSETLQVNQPRTSRESAELERRFRN
FT                   LELRQKNLVEQVSKRGELEYLAVAKNGAGRYWITVAGTGKPFMRESFATPGFCWECAVE
FT                   IEANFEILQVIELRPPETIERIEEMVQAVLERERVAESWGWG"
FT                   /protein_id="YP_001521514.1"
     MTPPIVALNP KPIPQTIPQL PKSVPSSLKL VSRTAFPKET PEGTRPPKRE QGYGELGGIR        60
     RSSRRASQTT RLKKVPHSTS SETLQVNQPR TSRESAELER RFRNLELRQK NLVEQVSKRG       120
     ELEYLAVAKN GAGRYWITVA GTGKPFMRES FATPGFCWEC AVEIEANFEI LQVIELRPPE       180
     TIERIEEMVQ AVLERERVAE SWGWG                                             205
//

If you have problems or comments...

PBIL Back to PBIL home page