(data stored in ACNUC30567 zone)

HOGENOMDNA: ACAM1_4.PE66

ACAM1_4.PE66         Location/Qualifiers
FT   CDS             complement(68417..69148)
FT                   /locus_tag="AM1_C0066"
FT                   /gene_family="HOG000113193" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transposase-associated ATP-binding protein,
FT                   putative"
FT                   /transl_table="11"
FT                   /note="Upstream region overlaps with a putative
FT                   transposase."
FT                   /db_xref="GI:158340521"
FT                   /db_xref="GeneID:5686288"
FT                   /translation="MLTHWESIESQAMQENWSYAEFLLALCETEAQRREQARLKRALTE
FT                   ARLPNAKSFTNFDFSHCPQLNPAPLMQLAADPGWLERAENCLILGPSGVGKTHLATGVS
FT                   KKMLEFGKRVKFFAANALVQQLQQAKLQLQLHPMLKKLDRYDLLILDDLGYCKKSEAET
FT                   SVLFELIAHRYERKSLLITANQPFSQWDDIFTDSMMAVAAIDRLIHHGLIIEIQADSYR
FT                   RKSATQRTAQTQSPPQKSQSK"
FT                   /protein_id="YP_001521515.1"
     MLTHWESIES QAMQENWSYA EFLLALCETE AQRREQARLK RALTEARLPN AKSFTNFDFS        60
     HCPQLNPAPL MQLAADPGWL ERAENCLILG PSGVGKTHLA TGVSKKMLEF GKRVKFFAAN       120
     ALVQQLQQAK LQLQLHPMLK KLDRYDLLIL DDLGYCKKSE AETSVLFELI AHRYERKSLL       180
     ITANQPFSQW DDIFTDSMMA VAAIDRLIHH GLIIEIQADS YRRKSATQRT AQTQSPPQKS       240
     QSK                                                                     243
//

If you have problems or comments...

PBIL Back to PBIL home page