(data stored in ACNUC30567 zone)

HOGENOMDNA: ACAM1_4.PE67

ACAM1_4.PE67         Location/Qualifiers
FT   CDS             complement(68976..70712)
FT                   /locus_tag="AM1_C0067"
FT                   /gene_family="HOG000139033" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transposase, putative"
FT                   /transl_table="11"
FT                   /note="Downstream region overlaps with a putative
FT                   transposase-associated ATP-binding protein."
FT                   /db_xref="GI:158340522"
FT                   /db_xref="GeneID:5686289"
FT                   /translation="MPNKRIDSYHTRVYMNGRDLGLKQADAAYIAEISTRTGQRIEAGT
FT                   HQPNRGRLQDQRTVPDPLADVWEDELEPMLRRDPRLKPMTLYEYLQDKYPGQYPQVLRT
FT                   LQRRVRTWKALHGPSPEVMFELRHEPGVQGFSDFTELKGITITIAGKPFEHLIYHYRLG
FT                   YSGWRYAQIIQGGESFVALSEGLQNAFAACGGVPTQHRTDSLSAAYRNMGGRRSKNLTR
FT                   LYDELCDHYRLEPTRNNKGVAHENGSIESPHGHLKNRIKQAIYLRGSADFTSVAEYQAL
FT                   IDAQVAKLNQQCQTKYEQEKDHLQPLPKYRTPDYEVLTAKVSKRSTIDVRCILYTVPSR
FT                   LIGRQLELHLYHDRIVGYLERHPVVELPRKRVSGKGKRRDRCINYRHVIGSMRLKPRAF
FT                   IYCTWQSDLLPNPEYRQIWEQLKAQFDLEQAAKIIVEALYIAAVQDKEQAVAVYLQQQL
FT                   RSSSLTLNRLKKQFEPPQMKQVPELSIEQHSLELYDKLLPSCSVPAEPLPAPEPLFKKA
FT                   QALPHVDPLGIYRIPSHAGKLVLCGILTSLVRNGGPTKRTSSSKTCPHRSQAPKRKKFY
FT                   QL"
FT                   /protein_id="YP_001521516.1"
     MPNKRIDSYH TRVYMNGRDL GLKQADAAYI AEISTRTGQR IEAGTHQPNR GRLQDQRTVP        60
     DPLADVWEDE LEPMLRRDPR LKPMTLYEYL QDKYPGQYPQ VLRTLQRRVR TWKALHGPSP       120
     EVMFELRHEP GVQGFSDFTE LKGITITIAG KPFEHLIYHY RLGYSGWRYA QIIQGGESFV       180
     ALSEGLQNAF AACGGVPTQH RTDSLSAAYR NMGGRRSKNL TRLYDELCDH YRLEPTRNNK       240
     GVAHENGSIE SPHGHLKNRI KQAIYLRGSA DFTSVAEYQA LIDAQVAKLN QQCQTKYEQE       300
     KDHLQPLPKY RTPDYEVLTA KVSKRSTIDV RCILYTVPSR LIGRQLELHL YHDRIVGYLE       360
     RHPVVELPRK RVSGKGKRRD RCINYRHVIG SMRLKPRAFI YCTWQSDLLP NPEYRQIWEQ       420
     LKAQFDLEQA AKIIVEALYI AAVQDKEQAV AVYLQQQLRS SSLTLNRLKK QFEPPQMKQV       480
     PELSIEQHSL ELYDKLLPSC SVPAEPLPAP EPLFKKAQAL PHVDPLGIYR IPSHAGKLVL       540
     CGILTSLVRN GGPTKRTSSS KTCPHRSQAP KRKKFYQL                               578
//

If you have problems or comments...

PBIL Back to PBIL home page