(data stored in ACNUC30567 zone)

HOGENOMDNA: ACAM1_4.PE68

ACAM1_4.PE68         Location/Qualifiers
FT   CDS             71092..71457
FT                   /locus_tag="AM1_C0068"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340523"
FT                   /db_xref="GeneID:5686290"
FT                   /translation="MPPIPIRWVLIRDPQGRCKPQALLCTDLEISSIKMMQWFRQGWQV
FT                   EVTFEEVRAHLGVETQRQWSDQAILRTTPALLALFSIVTALAHQLQSTHPVACPMTAWY
FT                   RKLNPSFADALAQVRRH"
FT                   /protein_id="YP_001521517.1"
     MPPIPIRWVL IRDPQGRCKP QALLCTDLEI SSIKMMQWFR QGWQVEVTFE EVRAHLGVET        60
     QRQWSDQAIL RTTPALLALF SIVTALAHQL QSTHPVACPM TAWYRKLNPS FADALAQVRR       120
     H                                                                       121
//

If you have problems or comments...

PBIL Back to PBIL home page