(data stored in ACNUC30567 zone)

HOGENOMDNA: ACAM1_4.PE7

ACAM1_4.PE7          Location/Qualifiers
FT   CDS             complement(3293..3634)
FT                   /locus_tag="AM1_C0007"
FT                   /gene_family="HOG000022978" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340462"
FT                   /db_xref="GeneID:5686229"
FT                   /translation="MDVQLLEVLSIQLNVGDILEIAFTGEEFASEQMIEIPIACKLVKK
FT                   DTLLLYFHPHELDLDLNTLDIHSKKDQRYLTVHSLEIVDAEKGYLATYEEEEFVRYQVM
FT                   WKKIANISD"
FT                   /protein_id="YP_001521456.1"
     MDVQLLEVLS IQLNVGDILE IAFTGEEFAS EQMIEIPIAC KLVKKDTLLL YFHPHELDLD        60
     LNTLDIHSKK DQRYLTVHSL EIVDAEKGYL ATYEEEEFVR YQVMWKKIAN ISD              113
//

If you have problems or comments...

PBIL Back to PBIL home page