(data stored in ACNUC30567 zone)

HOGENOMDNA: ACAM1_4.PE74

ACAM1_4.PE74         Location/Qualifiers
FT   CDS             complement(72752..73027)
FT                   /locus_tag="AM1_C0074"
FT                   /gene_family="HOG000276232" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="RNA-binding protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340529"
FT                   /db_xref="GeneID:5686296"
FT                   /translation="MSIYVGNLSYEVAQEDLRAIFSEYGEVTNVHLPKDRETGKLRGFA
FT                   FVDLGNDADEVKAIEDLDGAEWMGRSLKVNKARPREKNRGSSRKRE"
FT                   /protein_id="YP_001521523.1"
     MSIYVGNLSY EVAQEDLRAI FSEYGEVTNV HLPKDRETGK LRGFAFVDLG NDADEVKAIE        60
     DLDGAEWMGR SLKVNKARPR EKNRGSSRKR E                                       91
//

If you have problems or comments...

PBIL Back to PBIL home page