(data stored in ACNUC30567 zone)

HOGENOMDNA: ACAM1_4.PE75

ACAM1_4.PE75         Location/Qualifiers
FT   CDS             complement(73270..74019)
FT                   /locus_tag="AM1_C0075"
FT                   /gene_family="HOG000287552" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340530"
FT                   /db_xref="GeneID:5686297"
FT                   /translation="MINPGQAGVVSILGKARDVAFLEGIHFKPPLISAVDVYDVTVQKF
FT                   EVPAQSSTKDLQDLNARFAINFRLDPIQVVEIRRTQGSLENIVTKIIAPQTQESFKIAA
FT                   SRKTVEEAITQRTELKQDFDDVLGARLDKYGIIVLDTSVVDLEFSPEFAKSVEDKQIAE
FT                   QRAKRAIYVAQEAEQEAQAEINRARGKAEAQRLLAETLKAQGGELVLQKEAIQAWREGG
FT                   SQVPEVLVNGGSEQSGVPFLFNIKDAH"
FT                   /protein_id="YP_001521524.1"
     MINPGQAGVV SILGKARDVA FLEGIHFKPP LISAVDVYDV TVQKFEVPAQ SSTKDLQDLN        60
     ARFAINFRLD PIQVVEIRRT QGSLENIVTK IIAPQTQESF KIAASRKTVE EAITQRTELK       120
     QDFDDVLGAR LDKYGIIVLD TSVVDLEFSP EFAKSVEDKQ IAEQRAKRAI YVAQEAEQEA       180
     QAEINRARGK AEAQRLLAET LKAQGGELVL QKEAIQAWRE GGSQVPEVLV NGGSEQSGVP       240
     FLFNIKDAH                                                               249
//

If you have problems or comments...

PBIL Back to PBIL home page