(data stored in ACNUC30567 zone)

HOGENOMDNA: ACAM1_4.PE76

ACAM1_4.PE76         Location/Qualifiers
FT   CDS             complement(74220..75284)
FT                   /locus_tag="AM1_C0076"
FT                   /gene_family="HOG000023001" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340531"
FT                   /db_xref="GeneID:5686298"
FT                   /translation="MTQYSELKSALQPHLNWHGARLSFLTLFLLALFKVKTVNLSELAL
FT                   GFEGSAQSDSKYKRLQRFFRGFDLEYATIAKLVIDWMQTPQPWVLSIDRTTWEFGTHCF
FT                   NILSIGVVHEGVAFPLLWWMLQKKGNSSSDERMRFVEALLHICPDLQIRYLCGDREFIG
FT                   QLWVRYLRLAPLLPFRLRIRATDKIERQGKALQTKVVFAHLQVGQRQRLKGDCRVWGQP
FT                   VAVEGLRLEDGALLVVIGPTQDDQLIDDYALRWGIETLFGIFKTRGFCLESTHFTEAER
FT                   LRKLFALLTLALYWAMKTGLFLHQLKPIALKTHERRAKSLFRLGFDHFRQMILNPSPGN
FT                   EREFLQSLQLLSST"
FT                   /protein_id="YP_001521525.1"
     MTQYSELKSA LQPHLNWHGA RLSFLTLFLL ALFKVKTVNL SELALGFEGS AQSDSKYKRL        60
     QRFFRGFDLE YATIAKLVID WMQTPQPWVL SIDRTTWEFG THCFNILSIG VVHEGVAFPL       120
     LWWMLQKKGN SSSDERMRFV EALLHICPDL QIRYLCGDRE FIGQLWVRYL RLAPLLPFRL       180
     RIRATDKIER QGKALQTKVV FAHLQVGQRQ RLKGDCRVWG QPVAVEGLRL EDGALLVVIG       240
     PTQDDQLIDD YALRWGIETL FGIFKTRGFC LESTHFTEAE RLRKLFALLT LALYWAMKTG       300
     LFLHQLKPIA LKTHERRAKS LFRLGFDHFR QMILNPSPGN EREFLQSLQL LSST             354
//

If you have problems or comments...

PBIL Back to PBIL home page